KEGG   Bombyx mori (domestic silkworm): 101735953Help
Entry
101735953         CDS       T02817                                 

Definition
(RefSeq) protein O-GlcNAcase
  KO
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101735953
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     101735953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 982 aa AA seqDB search
MTESSPDEPSTKRKDFICGVVEGFYGRPWTTEQRKDLFQKLKKWGMDIDTTLKRKLEQVS
QFGCTCFALLFDDIEPEMSEADKQTFQSFAHAQVSITNEIHQHLGCCRFLLCPTQYCSTR
AVPTVTSSEYLNTLGSKLSQQIEIMWTGPKVISKTLTTECIEEITQVLRRPPVIWDNLHA
NDYDQKRIFLGPYCGRSPELIPLLRGVLTNPNCEYNANMVPVRTLAHWAACSLDAPAAME
AVSWDIKLERESEQGVCEDESPLPLGRHVYHPRQALRQAINEWLPEFSIPKTAQGPVVKP
QTPTIVPPVPIIPILPSVNTCMSLVTATSSTCSTTTAELGPAIPTLSTTHLQALTDRPIL
ATTVSPIENFNPVANPVMNSLVSPTKVILNESIPNPIIPIASSNISLPSEIPVSTLPVPI
LGLKSLDDTIKIPSVSEAVLNPSVVESDSFAEENKKEEEDNIVVDDVEPSIEVQQNGDMS
VGDTPQTLSPTRAVPEPGIEPLDVDPPSNTGTDPDVVMTDGLSENGSMQVEASNSPLSSD
MMVEPPDTTENTDEPEDNEDLTAEDLLLLCEAFYLPFEHGARALRMLHDFHWLTSHAAIT
LRANRSSAAPETSEWTRRRARFSFWAGRSRRVLRRAGRAANRDLHSELQPYLWELCAVLA
LLDAFLKWLELGKFPPNITNNIQGSYTWFSKGWREAFESGAQEPWVFRGGVVADLRRLLP
VDCGDVLRSPPRAPDLPLAPRPYRPADELEIYEIYNKTCREGDVSSDMFPSDLQSLPTDR
LIAPFLHLSPDLCMVLEDDGSFTHSDATTPDSEPSDPDNKDMPSSKMNGVRKEVVGFACA
ALDSKEFYRLQEIAWVPELCEKYPLSLLDRTDLSEAAKEYIRELHGGGAGGAAGGAGEAA
EAAETARRGAAAEVRCGAVPAADSLAPARMLTCLLAALRASGANGVHTTVSAADTQLQQF
YSKLGFVEVSRARGQLYLARPL
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaagttcaccagatgaaccgagcacgaagcgcaaagactttatctgcggtgta
gttgaaggcttttacggccgcccatggacaactgaacaaagaaaggacctattccaaaaa
ctcaaaaaatggggtatggacatagatacaactttgaaacgtaaattagaacaggtttca
caatttggatgcacttgttttgcactgctatttgatgacattgaaccagaaatgagtgag
gcagacaaacaaacgtttcagagttttgcacatgcacaagtatcaattacgaatgagatc
caccagcatttgggatgctgtcggttcttactctgtcccactcagtactgttcgactcga
gccgttccgactgtcaccagctcagaatacttgaacacccttggctctaaactttctcaa
cagattgaaataatgtggacaggaccaaaagtgatatcaaaaacgttgacgactgagtgt
atagaagaaataacgcaggtccttcgtcggccgcccgtcatctgggataacttgcacgcc
aatgactacgatcaaaagaggatatttttaggtccgtactgtgggcgctccccggagctg
atcccgctgctgcggggcgtgctgacgaacccgaactgcgagtacaacgccaacatggtg
cccgtgcgcacgctcgcgcactgggccgcctgcagtctggacgcgcccgccgccatggaa
gcggtctcgtgggacataaagctggagagggagagcgagcagggcgtctgcgaggacgag
agcccgctgccgctcggccgtcacgtctaccaccctcgccaggcgctgcgacaagcaata
aacgagtggctgcccgagttctctatacccaaaacggcccagggaccagtcgtgaagccg
caaactccgaccatagtgcccccggtgccgataatcccgatcctgccgtcagtgaacacg
tgcatgtcgctggtgacggccaccagcagcacgtgcagcaccaccaccgccgagctgggg
cccgccatccccacgctgtccaccacccacctgcaggcgctcaccgaccgccccatcctc
gccaccacggtatcgccgatcgagaacttcaaccccgtggcaaatccggtgatgaattcc
ttagtgtctcccactaaagtgatccttaacgaatctatacccaaccctatcatccccatc
gctagttctaatatatccttgccctcagaaataccggtttccacattaccggtaccgatc
ctaggtttgaaatctctggacgataccatcaaaataccaagtgtgagtgaagcagtgttg
aaccctagtgttgtggaaagtgacagttttgcggaagaaaataaaaaggaagaagaggat
aatatagttgtggacgacgtggaaccctccatagaggttcagcagaatggggatatgagt
gtcggagatacaccgcaaaccttgagccctacccgtgcagttcccgagccgggcatcgaa
cctctagacgtggacccgccctcgaacaccggcaccgatccggatgtagtcatgaccgat
ggtctaagcgagaacggttcaatgcaagtcgaggccagcaacagtccactcagctccgac
atgatggtggagccgcctgacacgactgaaaatactgatgagccggaagataacgaagat
ctaactgctgaggacttgctgctgctgtgcgaagccttctatctacccttcgagcacggc
gcgagagctcttcggatgctgcacgacttccactggttgaccagccacgccgccatcacg
ctgcgagccaaccggtccagcgctgcccctgagacgagcgagtggacccgccggcgggcg
cggttctcattctgggcggggcgcagccgccgggtgctccggcgcgcgggccgggctgcc
aaccgggacctgcactccgagctgcagccctacctgtgggagctatgcgccgtgctcgcg
ctgctcgacgccttcctcaagtggttagaactagggaagtttcctccgaacattacgaac
aacatccaagggagctacacatggttctcgaagggttggcgggaagcgtttgagagtggc
gctcaggagccctgggtgttccgcggcggcgtcgtggctgacctgcggcgcctgctgccc
gtggactgcggcgacgtgctgcggtcgccgccgcgggccccggacctgccgctcgcgccg
cgcccctaccgacctgccgacgaactcgagatatacgagatctacaacaagacgtgtcgt
gaaggtgacgtcagcagcgacatgttccccagcgatctccagtcgctgcccacggaccgg
ttaatagcaccattccttcatctgtcgcccgatttgtgtatggtattggaggacgacggc
tcgttcacgcattccgatgcgacgacgccggattctgaaccctcggaccctgataataag
gatatgccgtcgtcgaaaatgaacggtgttcgaaaggaagtggtggggttcgcgtgcgcc
gcgctcgacagcaaggagttctaccggctgcaggagatcgcctgggtgccggagctgtgc
gagaagtacccgctgtccctactcgacaggaccgacctcagcgaagccgctaaagagtac
atccgcgagctgcacggcggcggggcgggcggcgcggcgggcggcgcgggggaggcggcg
gaggcggcggagacggcgcggcggggcgcggcggcggaggtgcggtgcggcgcggtgccg
gcggcggactcgctggcgcccgcgcgcatgctcacgtgtctgctggcggcgctccgggcc
agcggagcgaacggcgtccacacgacagtgagcgcggcggacacgcagcttcagcagttt
tacagcaagctgggcttcgtggaggtgtcccgggcccggggacagctctacctggcgcgc
ccgctctag

DBGET integrated database retrieval system