KEGG   Bombyx mori (domestic silkworm): 101736381Help
Entry
101736381         CDS       T02817                                 

Definition
(RefSeq) alpha-amylase 4N-like
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101736381
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101736381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 517 aa AA seqDB search
MHFDTTLAHIASLHAGIHILLSWLLTLATSVVAYKNPHYVTGRSVNVHLFEWKWNDIADE
CERFLGPRGFGGIQISPPNENVVLWTYNRPWWERYQPISYELVTRSGNERQFADMVRRCN
AAGVRIYVDAVINHMTGEPPENIGTAGNTAVYREWYYPAVPYRAEHFNWPHCVIDGSDYV
NDALRVRNCELVGLKDLNQANEHTRNMIVNFMNKLIDLGVAGFRIDAAKHMWPEDLLIIY
NRLNNLNTAHGFPSNARPYIYQEVIDYGGEAISRDEYTPIGAVTEFKAGMELSRAFRGNN
QLRWLSSWGTQWGLLAHSDSLTFIDNHDNERGHGGGGGVLTYKEPRPYKAAIAFLLAHPY
GEPQIMSSFLFWDSEIGPPMDHSGNIISPAINSDGTCGNGWVCQHRWRQIYSMVAFRNVA
GNTDVVEWWDNGSNQIAFCRGTKAFIAFNNDRWDLNQSLQTCLPAGSYCDVISGSKIGSW
CQGKTVTVQSDGRAQIQVGANDYDMMLAIHVGPESRI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgatactacgcttgcacatatagcttcattgcatgccggtatccatatactc
ttgtcatggttattgactttggcaacaagtgtggttgcgtacaaaaacccgcactatgtg
accggtcgttctgtcaacgtgcatcttttcgaatggaaatggaacgacattgctgacgag
tgtgagcgattcttgggacctagaggctttggaggaatacagatatcgccccccaacgag
aatgttgtgctatggacatacaacagaccctggtgggagcggtaccagccgatttcatat
gagctagtaactcgctcaggaaatgaaaggcaattcgctgatatggtgaggagatgcaat
gctgctggagttaggatttacgtggacgccgtcattaatcatatgactggcgaacctcca
gagaatatcgggactgcgggtaacactgctgtttaccgggaatggtattaccctgctgtt
ccataccgagcggaacatttcaactggcctcactgtgttattgatggttctgactacgtc
aatgacgctttgagggtacgcaactgtgagctggtaggcttgaaggatctcaatcaagct
aatgagcacaccagaaacatgattgtcaattttatgaacaaactcattgacttaggtgtc
gccggatttaggattgacgcagcaaaacacatgtggcctgaggatctgcttattatttac
aatcgtttgaacaatcttaacactgcccacggctttccgtccaacgctcggccctacatc
tatcaggaagtcattgactacggcggtgaggcaatcagtagggacgagtacactcctatt
ggtgctgtaaccgaattcaaggccggcatggaacttagcagagcattcagagggaataat
caacttcgttggttatcaagctggggaacgcaatggggccttttagcccacagtgactcc
ttaacttttattgacaatcacgataacgaaaggggacacggaggtggaggaggagtcctc
acgtacaaagaaccacgtccatacaaagccgctatcgctttcctacttgctcatccgtac
ggagagccccagataatgagtagtttcctgttttgggattcagagatcggaccacctatg
gatcattcgggaaatattatatcacctgctatcaactcggatggaacctgcggtaacggt
tgggtttgccaacaccgctggagacagatttacagcatggtcgcctttaggaacgtggca
ggaaacactgatgtcgttgagtggtgggataatggcagtaatcagattgccttctgtcga
ggcactaaagcttttattgctttcaataacgaccgttgggaccttaatcagagtttgcag
acttgtcttccagcgggtagttactgcgacgtgatatctggcagtaaaattggtagttgg
tgtcaaggtaaaaccgtgactgttcagagcgacggacgagctcaaattcaagtgggtgcc
aacgattatgacatgatgctggccatccatgttggacccgagagtcgcatatga

DBGET integrated database retrieval system