KEGG   Bombyx mori (domestic silkworm): 101736417Help
Entry
101736417         CDS       T02817                                 

Definition
putative glycogen [starch] synthase-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101736417
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101736417
Glycosyltransferases [BR:bmor01003]
 Polysaccharide
  Storage polysaccharide
   101736417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 692 aa AA seqDB search
MSKDRSSRRFYRAESTHDLSSFMDRGRAASDENRWTFECAWEVANKVGGIYTVIRSKAFV
STEEMGDNYCLLGPYKEQCARTEVEEGEFPSDSPLLTAVNAMRSKGYKLHTGTWLVDGNP
QIVLFDIGSGAWQLDAYKQELWDTCSVGIPHLDVEANDAVILGFMVAQFISEFREAVEGR
GGVPARVVAQFHEWQAGIGLIVLRVRHVDVATVFTTHATLLGRYLCAGNTDFYNNLDKFS
VDEEAGKRQIYHRYCMERAASHMAHIFTTVSDITGYEAEYLLKRKPDIITPNGLNVKKFS
ALHEFQNLHALAKDKIHEFVRGHFYGHFNFDLDKTLYFFIAGRYEFGNKGADIFIEALAR
LNHYLKSSGSEVTVVAFLIFPAKTNNFNVESLRGHALTKSLRDTIQHVQQRVGARMYDVC
LRGHVPEPTELLLKEDTVRLKRCIYALQRDGLPPVTTHNVVDDWSDPVLNSIRRCELFNT
VNDSVKVIFHPEFLTSTNPLFGLEYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYVVDRRYISLEGSVQQLAQYMYDFTKMSRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARARALRTVYPEYVDHADVQLERAFTYPRPLSEPPSPAHSR
ATTPAASVHGSDSEEDEVDDEKELAELRISHD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaggatcgcagctcgaggcggttctatcgtgcggagtccactcatgatctgtcg
tcattcatggaccgcggccgcgccgccagcgacgagaacagatggaccttcgagtgcgcc
tgggaagtcgccaacaaagttggcggtatttatacggtaataagatcgaaagcattcgtc
tccactgaagaaatgggagacaactattgcttgcttggtccgtataaggagcaatgcgcg
cgaactgaagtcgaagagggagagttcccctccgactcccccctgttgacagccgttaac
gccatgaggagtaaaggttacaagttacacacgggcacttggctggtagatgggaaccct
caaatagttcttttcgacatcgggtctggggcgtggcagttggatgcttacaagcaggag
ctatgggacacttgctccgtcggcatcccgcatctcgacgtggaggccaacgacgccgtg
atcctagggttcatggtcgcgcagttcataagcgagttccgcgaggcggtggaggggcgc
ggtggggtgccggctcgcgtggtggcgcagttccacgagtggcaggcgggaatcgggctc
atcgttctaagggtacgccatgttgacgtggcgaccgtattcacgactcacgcgacgctc
ctcggcagatacctctgcgctggcaacacagacttctacaataacctggataagttctct
gtggacgaggaggcgggaaagagacagatataccaccgctactgcatggagcgggccgcc
tcgcacatggcacacatcttcaccaccgtctccgacatcacgggatacgaagccgagtac
ttgctcaaacggaagccggacatcatcaccccgaacggtttgaacgtgaagaaattctcg
gcgctgcacgagttccagaacctgcacgccctcgccaaggacaagatacacgaattcgtt
aggggacatttttacggccatttcaatttcgatctggacaaaacgttgtatttcttcatc
gccggacgatacgagttcgggaacaagggagccgacatattcattgaggcgctggcgaga
ctcaaccattatttgaagtcgtcgggctccgaggtgacggtggtggcgttcctgatcttc
ccggcgaagacgaacaacttcaacgtggagtccctccgcgggcacgcgctcaccaagtcc
ctgcgcgacaccatccagcacgtgcagcagcgcgtcggcgccaggatgtacgacgtgtgc
cttcggggccacgtgccggagcccaccgagctgctgctgaaggaagacacggtgcgcctc
aaacgctgcatttacgcgctgcagcgggacggcctgccccccgtcaccacgcacaacgtc
gtggacgactggagtgatcctgtgctgaactccataagaagatgcgagctgttcaacact
gtcaatgacagtgtcaaggtgatattccacccggagttcctgacgtccacgaaccccctg
ttcggtctggagtacgaggagttcgtgcgcggctgccacctcggcgtgttcccctcgtac
tacgagccctggggctacacgccggccgagtgcaccgtcatgggcatacctagcatcacg
accaacctgtccgggttcggttgcttcatgcaggagcacatcgcggaccccatgtcctac
gggatctatgtggtggaccggcggtacatctcgctggagggctccgtgcagcagctcgcg
cagtacatgtacgacttcaccaaaatgtctcgccgtcagcgcatcatacagagaaaccga
actgagagactgtcggatctactggactggagaaaccttggaatttactaccgccaggcc
cgcgcacgcgccctgcgcaccgtgtacccggagtacgtggaccacgcggacgtgcagctg
gagcgcgccttcacctacccgcgcccgctgtccgagccgcccagccccgcgcactccaga
gccacgactccggccgcctcggtccatggctccgacagcgaggaggacgaggtggacgac
gagaaggagctggctgagttgaggatcagccacgactga

DBGET integrated database retrieval system