KEGG   Bombyx mori (domestic silkworm): 101736749Help
Entry
101736749         CDS       T02817                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101736749
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101736749
Transcription machinery [BR:bmor03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101736749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 809 aa AA seqDB search
MSQATDEIADIAMTSTEPDSSQNHTHEATSSLSADDASSSNAGTPAGSEGQASRQSNLQR
IQQRKQQVFNWPHNKKLLKLAIYSACQTPDCNCNGWKTPVTQHAGKTPRADNQPLASFND
VCRNCNHVLEKHVSQLQGLPVAEVNRLLGAVVDVENIFMSMQREDDHNTKQVYYYLFKIL
RKCILTRSQPRIEGPLGQPPFERPSIAKAITNFVLYKFNSLPQREWQTMYDLAKMFLHCF
NHWNFETPSVRKLQVSNPEDISAYQINYTRWLVFCHVPAFCDSLPHYDTSLVFGRTLLRA
VFKSVCRQLMDKCHLERDRMPPEKRVLVLTHFPRFLALLEEEIFSPNSPIWDPDYKQVPP
NHLQAMLDNKTSSRRVGEFERVTASGDSKDGFTTVTLSSGSIKQEGVKRAGVSVSGTGGK
RRRVCSEGSDDVSQRTVADIVATISDPNYMCGPDALFQTQAPRDEAAKIEEQRKLIEFHV
IGNSLTGPVNKQTMLWLIGLHNVFSHQLPEMTKEYISQLVFDPKHKTLALIKEGRPIGGI
CFRTFHSQGFSEIVFCAVTSNEQVKGYGTHLMNHLKDYHIRNNILHFLTFADEFAIGYFK
KQGFSKDIKLPRAMYQGYIKDYEGATLMHCELNPRIVYTQFTSVIRMQKEIVKKLIDMRQ
KEVRKIYPGLTCFKEGVRSLPPECIPGAREAGWRAPPPPHDPDPDPVTLRNVLHAVKNHA
TAWPFLKPVDKAEVPDYYDHIKYPMDLRTMGERLKARYYVSKRLFIADMTRIFNNCRLYN
SPDTDYYRCANTLEKYFQTKMKEVGLWDK
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagcgactgacgaaatagctgacatagcaatgacaagcacagagccagactcc
tcacaaaatcatacacatgaagctacatcaagcttaagtgcagatgatgcatcatcaagc
aatgccgggactcctgcaggcagtgaaggacaggcttcccggcagtctaacctacaaagg
atacaacaaagaaaacaacaagttttcaactggccccataataaaaaactactcaaacta
gctatatattcagcctgtcagacaccagattgtaactgcaatggatggaagactccagta
acacagcatgcgggcaagactcctcgggctgataatcagccccttgccagcttcaatgac
gtgtgtagaaactgcaaccatgtattagagaaacatgtaagtcagctacaaggtttgcct
gtagcagaagtgaataggctgctcggtgctgttgtagacgtagagaacatatttatgtcg
atgcaaagagaagatgaccacaacactaaacaagtttactactatttatttaagatactt
cgtaaatgcatcttaacgcgttcccagcctcggatcgagggaccactgggacaacctcca
ttcgaaaggccttccatagctaaagcaataacaaacttcgttctctacaagttcaattca
ttaccacaaagggaatggcaaacaatgtacgatttggccaagatgttccttcactgtttc
aatcattggaattttgaaacgcccagcgtcaggaagctgcaagtttcaaaccctgaagat
atatcagcctaccagattaattatacgagatggctcgtgttctgccacgtgcccgcgttc
tgcgactcgctgccccactacgacacgtcgctggtgttcggacggacgctgctgcgcgcc
gtgttcaagtccgtgtgccgccagctcatggacaagtgccacttggagagggacagaatg
ccgccagagaaaagggtactggttctgacccacttccctcggttcctggctctattggaa
gaagaaatatttagtccaaactctccgatctgggacccggactacaagcaagtgccgcct
aatcatttacaagcgatgctggataataaaacttcaagtcgtcgtgtcggtgaatttgaa
cgagttacggcatccggagacagtaaggatgggttcacgacggttacactgtcatctggt
tcgataaagcaggagggcgtgaagcgtgcgggcgtgagtgtgagcgggacgggcggcaag
cggcgccgcgtgtgctctgagggcagcgatgacgtcagccagcgcacggtggccgacatc
gtggcgactatctccgaccccaactacatgtgcggaccggacgcattattccaaacgcaa
gcaccgcgcgacgaggcggccaaaatcgaagaacaaagaaaattaatagagttccatgtg
atcggcaactctctgactgggcccgtcaacaaacagacaatgctatggttgatcggtctc
cacaacgttttctcccaccaactaccggaaatgactaaagaatacatatcgcaattagtg
ttcgatccgaaacacaagacattggctctgatcaaagaaggcaggccgattggtggcatc
tgcttcaggacattccattcgcaaggcttcagcgagatagtattctgtgcggtcacgtcc
aacgaacaagtgaaaggatacggcactcacctcatgaaccacctcaaggattaccacatc
cgaaacaatatactgcacttccttaccttcgctgatgaatttgcaataggctacttcaag
aagcagggtttcagtaaagacattaagctgccgagggcgatgtaccaaggatacataaag
gactacgagggagcaaccctcatgcactgcgaattgaaccctagaatagtatacacacag
ttcacttcggttattaggatgcagaaagagatcgtaaagaaacttatagatatgcgacag
aaggaagttagaaaaatttatcccggcctcacttgcttcaaggaaggtgtccgcagcctc
cccccggagtgcatccccggggcgcgcgaggcagggtggcgcgcccccccgcccccgcac
gaccccgaccccgaccccgtcaccctgcggaacgtgctgcacgcagtaaagaaccacgcg
acggcctggccgttcctgaagccggtcgacaaggcggaggtgccggactactacgatcac
atcaagtatccgatggacttgcgcacgatgggggaacgtctcaaagcgcgctactacgtg
tccaagcggctgttcatagcggacatgacccggatattcaacaactgcagactctacaac
tcgcccgacaccgactactacaggtgcgcgaacacacttgagaaatatttccaaactaaa
atgaaagaggtcggactgtgggataaatga

DBGET integrated database retrieval system