KEGG   Bombyx mori (domestic silkworm): 101737288Help
Entry
101737288         CDS       T02817                                 

Definition
uncharacterized LOC101737288
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101737288
   00330 Arginine and proline metabolism
    101737288
   00340 Histidine metabolism
    101737288
   00350 Tyrosine metabolism
    101737288
   00360 Phenylalanine metabolism
    101737288
   00380 Tryptophan metabolism
    101737288
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101737288
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101737288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 544 aa AA seqDB search
MVQKLDETHKKSVKADVIILGCSLSGIVAAHKLKRRFGDSMDIVVLDLAGQTQSYSKYNV
VFEDVEKDSQDIITEPDFQGTAKQMIENVARFYLAKYAKEFHVPLPDVIIAPERVRTRLT
KLFQHQNGNTVECTNDFHEFDYLSVMERFEINQYQNMLDQSMKDLFQRHKVDLQAERNRL
RYYDQTCMESHIRGALLFPTSKEIMRSTVKLVCGAPANSVSVLFYLHQCYRTGSTKNHLD
GNNTKFREKTLGHCRKRLQKKLQQSIADITLSAKSIKEIRTYSDEQVILETIKGETDYVC
NLLAMALKPDQLDSIRVEDELLAVNLANKIRAMIPGRARRFVIQYEDNFWTKLGYSGDIL
SIRGPIIWAMEKPEMSTTGSLEKYPSLIGYLMVRDESDGDSKEAVIEQLIKLFGNNASSP
VNYKETNIADLFIPRCGDYVALKELTGEGSPKHLEWGTLDIFADGDVAAALEAGHTAYLN
LLTSLRPQAQTYEDRSTADWPRFLEDSPVQRWYSHVNFANGIHLLVYSAAAYYGLRVVRS
YFRK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtacagaaactcgatgaaactcataagaagagtgttaaagctgacgtaattatttta
ggatgcagtttatcagggatcgtggccgctcacaagctaaagaggaggttcggagattct
atggatattgtcgtgttagacctggcgggacagacacaaagctattccaagtataatgtt
gtcttcgaagatgtagaaaaggacagccaggatatcataaccgagccggattttcaagga
accgctaagcaaatgattgagaatgttgcgcggttttatctagctaaatatgccaaagaa
ttccacgtgccccttccagacgtcataatagccccggaaagagtcaggactaggttgacc
aagctgttccagcaccaaaacggtaacactgtagaatgtaccaatgacttccacgagttc
gactatctcagcgtgatggagaggttcgagattaaccaataccagaacatgttagatcag
agcatgaaggacttatttcagagacacaaagtagatttgcaagcagaaagaaataggtta
agatactacgatcagacgtgtatggaaagtcatatacggggggcattgttgtttccaact
tctaaagaaataatgagatctaccgttaagctggtctgtggcgcaccggctaattctgtg
tctgtgttattctatcttcatcaatgttacaggaccggcagtactaaaaaccatttagat
ggaaataatacaaagtttagggagaagactttgggtcactgtcggaaacgtctccagaaa
aaactgcagcagagcatcgctgacataactctgtccgctaaatctattaaggaaataagg
acatactctgatgaacaagttattctggaaacaataaaaggcgaaacagattatgtgtgt
aatttgttggcgatggcattaaaacctgaccagctcgacagcattcgagttgaggatgag
ctgctggcggtaaatttggctaataagattcgcgccatgattccgggtcgtgccaggagg
tttgttatacaatatgaagataacttttggacgaaattgggctacagcggtgacattctc
agcatacgtggtccaatcatctgggcaatggagaaaccagaaatgtctacgactggtagc
ttagagaaatatccctcactgatcgggtatttgatggtccgtgatgagagtgacggggac
agtaaagaagccgtcatagaacaacttataaaactattcggaaataacgcaagttcccca
gtgaactacaaagagacaaacatagcggatttgttcatacctaggtgtggagattatgta
gcacttaaagagctaacaggcgaagggagtccgaaacacttagagtgggggacgttggac
atattcgccgatggagacgttgctgctgctctggaagctgggcacactgcctaccttaat
ctgctgaccagcctccgtccgcaagctcagacatacgaggatcggagtacggcagattgg
ccacggtttctggaagatagccctgttcaaaggtggtattcccacgtaaattttgctaat
ggtatacatttactggtgtactctgctgctgcgtattacggcttacgtgttgtgaggtct
tatttccggaaataa

DBGET integrated database retrieval system