KEGG   Bombyx mori (domestic silkworm): 101737288Help
Entry
101737288         CDS       T02817                                 

Definition
uncharacterized LOC101737288
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bmor00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmor00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bmor00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bmor00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bmor00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bmor00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:bmor00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 544 aa AA seqDB search
MVQKLDETHKKSVKADVIILGCSLSGIVAAHKLKRRFGDSMDIVVLDLAGQTQSYSKYNV
VFEDVEKDSQDIITEPDFQGTAKQMIENVARFYLAKYAKEFHVPLPDVIIAPERVRTRLT
KLFQHQNGNTVECTNDFHEFDYLSVMERFEINQYQNMLDQSMKDLFQRHKVDLQAERNRL
RYYDQTCMESHIRGALLFPTSKEIMRSTVKLVCGAPANSVSVLFYLHQCYRTGSTKNHLD
GNNTKFREKTLGHCRKRLQKKLQQSIADITLSAKSIKEIRTYSDEQVILETIKGETDYVC
NLLAMALKPDQLDSIRVEDELLAVNLANKIRAMIPGRARRFVIQYEDNFWTKLGYSGDIL
SIRGPIIWAMEKPEMSTTGSLEKYPSLIGYLMVRDESDGDSKEAVIEQLIKLFGNNASSP
VNYKETNIADLFIPRCGDYVALKELTGEGSPKHLEWGTLDIFADGDVAAALEAGHTAYLN
LLTSLRPQAQTYEDRSTADWPRFLEDSPVQRWYSHVNFANGIHLLVYSAAAYYGLRVVRS
YFRK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtacagaaactcgatgaaactcataagaagagtgttaaagctgacgtaattatttta
ggatgcagtttatcagggatcgtggccgctcacaagctaaagaggaggttcggagattct
atggatattgtcgtgttagacctggcgggacagacacaaagctattccaagtataatgtt
gtcttcgaagatgtagaaaaggacagccaggatatcataaccgagccggattttcaagga
accgctaagcaaatgattgagaatgttgcgcggttttatctagctaaatatgccaaagaa
ttccacgtgccccttccagacgtcataatagccccggaaagagtcaggactaggttgacc
aagctgttccagcaccaaaacggtaacactgtagaatgtaccaatgacttccacgagttc
gactatctcagcgtgatggagaggttcgagattaaccaataccagaacatgttagatcag
agcatgaaggacttatttcagagacacaaagtagatttgcaagcagaaagaaataggtta
agatactacgatcagacgtgtatggaaagtcatatacggggggcattgttgtttccaact
tctaaagaaataatgagatctaccgttaagctggtctgtggcgcaccggctaattctgtg
tctgtgttattctatcttcatcaatgttacaggaccggcagtactaaaaaccatttagat
ggaaataatacaaagtttagggagaagactttgggtcactgtcggaaacgtctccagaaa
aaactgcagcagagcatcgctgacataactctgtccgctaaatctattaaggaaataagg
acatactctgatgaacaagttattctggaaacaataaaaggcgaaacagattatgtgtgt
aatttgttggcgatggcattaaaacctgaccagctcgacagcattcgagttgaggatgag
ctgctggcggtaaatttggctaataagattcgcgccatgattccgggtcgtgccaggagg
tttgttatacaatatgaagataacttttggacgaaattgggctacagcggtgacattctc
agcatacgtggtccaatcatctgggcaatggagaaaccagaaatgtctacgactggtagc
ttagagaaatatccctcactgatcgggtatttgatggtccgtgatgagagtgacggggac
agtaaagaagccgtcatagaacaacttataaaactattcggaaataacgcaagttcccca
gtgaactacaaagagacaaacatagcggatttgttcatacctaggtgtggagattatgta
gcacttaaagagctaacaggcgaagggagtccgaaacacttagagtgggggacgttggac
atattcgccgatggagacgttgctgctgctctggaagctgggcacactgcctaccttaat
ctgctgaccagcctccgtccgcaagctcagacatacgaggatcggagtacggcagattgg
ccacggtttctggaagatagccctgttcaaaggtggtattcccacgtaaattttgctaat
ggtatacatttactggtgtactctgctgctgcgtattacggcttacgtgttgtgaggtct
tatttccggaaataa

DBGET integrated database retrieval system