KEGG   Bombyx mori (domestic silkworm): 101738407Help
Entry
101738407         CDS       T02817                                 

Definition
annulin-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101738407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 764 aa AA seqDB search
MGAVKSKFARWYPGQWSCCRGIRGDSYDLKELPRPPQLDLSNDVIDGTRQGVLSVQNIDF
CTDINGEHHHTSRYNLMTRDEKKCLVVRRGQPFTLDLLLNRAYDPDKDAISFIIYVSDIE
KRGPSDGTSAAVPLLERGSETVGLWSAVYDSQVDSHLMVSVTAAADCMVAAWKVDIDTKL
IGGSSLSYTHPLPIYVLFNPWCLNDSVYMPGESHRDEYVLEQGGLMFRGVYNIIKPTPWN
YAQFEKDVLDCALYLVREVGKVTGSGRSSAIRTARALSAAVNVQDDNVVLFGNWGKELSD
YDGGTHPLKWVGSLAILQRFYEKKKPVKYAQCWVYAGILTTICRALGIPCRPVTGYDAAH
DSQGSLTIDIIMDEEGNTMDEFTRDSVWNYHVWNEVWMERPDLGPQYGGWQALDATPQET
SEDKFRCGPASLKAILDGELQRPYDATYVFAQVNADKILWKYSGEIQPLKLMARDTTSIG
QNISTKAIGKMEREDITDTYKYPERTREERMTMEKALRKSENIFARYYLNDAFNDVTFEF
DLRDDIKIGQDFSVVLHMKNRSTINEHQVKGTLRVDTVTYAGVTGDGVKRYEFDMKLKPE
QKEKVQMLVTFDDYFKKLIDQASFNIACLVTIVDRKFDYFAQDDFRVRNPDIKITIDGKP
VSRQEFTVHIKVENPLPIPLKNGKFYIQGPGLDEQLRIALDENVAPGTFATANFKLTPPW
AGRHQISAKFTSKEIRDIDGFLSFIVSMPETNGVSSETVETRQI
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgttaagagtaaatttgcacggtggtatcccgggcaatggtcgtgttgtagg
gggatcaggggagactcgtacgacctcaaggagttgccgcgtccgccgcaactggatctc
tcgaacgatgtgatcgacggaacgagacaaggtgtcttatcggtgcaaaacattgatttc
tgcaccgacatcaatggagaacatcaccacaccagcagatacaatttgatgaccagggat
gagaaaaaatgtttagttgtccgtagaggacagcccttcacgcttgatctgttgctcaat
agggcatatgatccagataaagacgctatttcattcatcatctatgtgtctgatattgag
aagcgtggcccttcagatgggacgtccgcagctgtgcctctgttggaaagaggctctgaa
acagttggattgtggagtgcggtctatgacagtcaagtggactctcatctcatggtgtcg
gtgacggcggccgctgactgcatggttgccgcttggaaagttgacattgacacaaagctc
attggaggtagctcattgagttacactcacccgttgccaatctacgtattgttcaatcct
tggtgtttgaatgattctgtgtacatgccaggtgagagtcatagagacgaatatgtattg
gaacaaggaggacttatgttcagaggagtgtacaacataattaagccgacaccgtggaac
tacgcgcaatttgaaaaagatgtcttagactgtgctctttatctagtcagggaagttggg
aaggtcacaggaagcggtagaagtagcgccatccggactgcccgagctctttcggcagcc
gtgaacgtgcaagacgacaacgttgtgctattcggaaattggggcaaagagctgagtgat
tacgacggaggaacgcatcctttgaagtgggttggctctctagcgatcctacagaggttt
tacgagaagaagaagcccgttaaatacgcccaatgttgggtatacgccggaattttaacg
acaatttgtcgggcactcggaattccctgcaggccggtaactggttacgatgcagctcac
gacagtcaaggaagcctcacgattgacataatcatggacgaggaaggaaatacgatggac
gaattcactcgagactccgtatggaactaccacgtttggaatgaagtatggatggagcgg
ccggatctgggcccccaatacggaggctggcaagctctggatgctactccacaagaaaca
tcagaagataaattcaggtgcgggccggcttcgttgaaagccattttagacggggaattg
cagcggccatatgatgctacatacgtattcgcacaagtaaacgctgataaaattttatgg
aaatattctggggaaattcaaccactaaagctaatggcacgtgacaccacctctatcggg
cagaatatctcaactaaagcgattggaaaaatggaaagagaggatatcaccgacacatac
aaatacccggaacgaacgcgcgaagagagaatgacaatggaaaaagcgttgcgcaaatca
gagaacatcttcgctcggtactatttgaacgatgccttcaatgacgtcaccttcgagttt
gatctcagagacgacattaagatcggacaggacttcagtgtggtcttgcatatgaaaaat
cgttcgacgatcaatgaacatcaagtcaaaggcacgttgcgagtggacacagtgacgtac
gccggcgtcaccggagacggcgtgaagcgatatgaattcgacatgaaactcaagccagaa
cagaaagagaaagtgcagatgctggtcaccttcgacgattactttaaaaagcttattgat
caggcatccttcaacatcgcatgcctagtcacgatcgtagatcgaaaattcgactacttc
gcacaggacgacttccgggtccggaatcctgacatcaaaataacgattgacggcaaaccg
gtctcccgccaagaatttaccgttcacatcaaagtggagaatcccttgcctattccgttg
aagaacggcaagttttatattcaaggtccaggtttggatgagcagctcagaattgcatta
gacgagaacgtggcacctggtacctttgcgactgctaacttcaagcttactcctccgtgg
gcaggcagacatcagatctcggctaagttcacatccaaagaaatacgggatattgacgga
tttctatcttttattgtgtcaatgccagaaaccaacggagtgtcttctgaaactgtagaa
acgaggcaaatctaa

DBGET integrated database retrieval system