KEGG   Bombyx mori (domestic silkworm): 101738534Help
Entry
101738534         CDS       T02817                                 

Definition
acyl-CoA Delta(11) desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101738534
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101738534
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101738534
Lipid biosynthesis proteins [BR:bmor01004]
 Desaturase
  First
   101738534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 311 aa AA seqDB search
MSRFQAPSNEDRDDVFSEEETRLEKLIAPQAEPREFKVVYRNIIVLLYYHMAGIYGLYLG
LIAAKWATVISAFITYCISGIGVTAGSHRLWSHKSYKVAYWVMVHRLHHKYSDSDADPHY
ATRGLFYSHMGWLMVRKHPEIEKRGKLLDLSDIYGNPYLKFQDTHYYWFLPLMSFLLPTI
IPMYFWGETCSVAWNVNMCRYVMNLNAIFLVNSVAHMWGYKPYDKNIAPSQNLSVSVLSL
GEGFHNYHHVFPWDYKCDELSSFRTNPTTVFIELCAKLGLAYDLRSASDDLIEGRAKRTG
DGSYLTLKKSR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgattccaggcgccctcgaatgaagaccgcgatgacgttttctctgaagaggag
acacgattggagaagctgatcgcccctcaagcagagcccagggagttcaaagtggtgtat
aggaatataatagtgcttctttactaccacatggccggaatatacggcctataccttgga
ctgatcgcagctaaatgggccacagtaatttcagcattcattacttactgcattagtggt
attggagtgacggcaggaagtcaccgactctggtcccacaagtcgtataaagtggcgtat
tgggtcatggtccatagactacaccataaatacagcgattccgacgctgatccgcactac
gcgacccgtgggctcttttactcccacatgggatggctgatggtgaggaagcaccctgaa
atagaaaaaagggggaagctgctggatttgtccgatatttacggaaatccctacctcaaa
ttccaggacacgcattactattggttccttccgctaatgtcgtttttattgccgacgatc
attcctatgtacttctggggggagacctgcagcgtcgcgtggaacgtcaacatgtgcaga
tacgtcatgaaccttaacgccatttttctggtgaacagcgtggcccatatgtggggatac
aagccttacgacaagaacattgccccttcacagaacctttcggtgtctgtgctgagcctg
ggcgagggctttcacaactaccaccacgtcttcccttgggactataagtgcgatgaattg
agctcgttcaggaccaaccctaccactgtatttatagagctgtgcgcgaaattggggctg
gcgtatgatctgaggagcgcttcggatgacttgatcgagggtagagccaagcggaccggc
gatggaagttatctgaccctaaaaaaaagtagatag

DBGET integrated database retrieval system