KEGG   Bombyx mori (domestic silkworm): 101738857Help
Entry
101738857         CDS       T02817                                 

Definition
(RefSeq) glutaminase kidney isoform, mitochondrial
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00220  Arginine biosynthesis
bmor00250  Alanine, aspartate and glutamate metabolism
bmor00471  D-Glutamine and D-glutamate metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101738857
   00220 Arginine biosynthesis
    101738857
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101738857
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101738857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank Ank_5 Ank_3
Motif
Other DBs
NCBI-GeneID: 101738857
NCBI-ProteinID: XP_004930134
Position
Un
AA seq 647 aa AA seqDB search
MAQYCVRRGGVSYVQIFCRKFSRLVVHVLPTLSVKVCVMRNLSSGRYEDFVMECDNAFEK
WRNSAPNFYSIQSVDIRVRDGPHKNADDVLFDMFKNEETGLLPVGKFLAALRTTGIRKND
ARVKEVMHSLYKVHKESNFEGGSPETLKLDRKTFKEVIAPNIVLITRAFRSQFVIPDFQD
FIKDIEEMYWAAKSNTDGKNASYIPQLTRASPESWGVSVCTIDGQRFSIGDVTVPFTLQS
CSKPLTYAMALETLGPDVVHNYVGTEPSGRNFNELILDYNMKPHNPMINAGAILVCSLLK
TLDKPEMTLAEKFDYVMSFFSRLAGNEVLGFNNAVFLSEREAADRNYALGFYMREHKCYP
EKTNLRECMDFYFQCCSMEANCDIMSIMAATLANGGICPITDEKVLRPDSVRNVLSLMHS
CGMYDYSGQFAFKVGLPAKSGVSGAMLIVVPNVMGICTWSPPLDPLGNSCRGLQFCDDLI
KRFNFHKYDNIRYASHKKDPRRYKFESTGLNIVNLLFSAASGDLSALRRHHLSGMDMTLS
DYDGRTALHLSAAEGHLACVEFLLAQCGVPHDPRDRWGSRPLNEAETFGHTAVVQYLKEW
ERAHPENPPVESPSSVDEILVTKPDATDAVKDPSIQEIVTRNGDKVQ
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtactgcgtacgcagaggaggcgtcagttacgtgcaaatcttttgcagaaag
ttttcgcggttagtggtacacgtgctaccaacactttcggttaaagtgtgtgttatgaga
aatttgtcatctggtagatacgaggatttcgtgatggagtgcgacaatgcttttgagaaa
tggcgcaactcagcacccaacttctattcgattcaatccgtcgatataagagtccgagat
ggtccacataagaatgctgatgatgtcctatttgatatgtttaagaatgaagaaacagga
ttacttccagttggaaaatttttggccgccctaagaaccaccgggataagaaaaaacgac
gcacgtgttaaagaggtaatgcatagcctgtacaaagttcacaaggaatctaatttcgaa
ggaggatctccagaaacactgaaacttgatcgaaagaccttcaaagaagttattgcacca
aatatagtgttgataactcgagctttccgaagtcagttcgtaattccagacttccaagat
tttatcaaggacatagaggaaatgtactgggctgcaaagagcaatactgatggtaaaaat
gcgagctatatcccgcaattaacgagagccagtcccgagagttggggcgtaagtgtttgc
acaattgatggtcaacgtttttctattggtgacgtgaccgtgccatttactcttcaatct
tgcagcaagcctttgacttatgcaatggcccttgaaactcttggtcctgacgtagtgcac
aactatgttggcacagaacctagcggacggaactttaatgaattgatcctcgattataat
atgaaaccacacaaccctatgatcaacgctggtgctattcttgtttgttcattactaaaa
acgctggacaaaccagaaatgacattggctgaaaaattcgactacgtcatgtcgttcttt
agtcgccttgctgggaatgaggtgttgggctttaataatgcagtatttttatcggaacgt
gaagccgccgaccgaaactatgctctgggtttttacatgagggaacacaaatgctacccc
gagaaaacaaatctgagggaatgtatggacttttatttccagtgctgttccatggaagca
aactgcgatataatgtcaattatggcggcaactttggctaacggaggaatttgtccgata
actgatgaaaaagtattgcgaccagactccgtgcgtaatgtgctgtcgttaatgcacagt
tgcggcatgtacgactactctggacagttcgctttcaaagtgggactccctgccaaatct
ggagtatcgggcgccatgcttattgtggtcccaaatgttatgggcatatgtacatggtca
ccgcctctagatccattgggaaatagctgcagaggcttacagttctgcgatgacttaatt
aaacgattcaattttcacaaatacgataacattcgttacgcgagccacaaaaaggatccc
cgccgatacaagttcgaatccacaggacttaatatcgtcaacttattgttctctgctgca
agtggagatctcagtgcactgagaaggcaccacctgtctggtatggacatgactttgtcg
gactacgatggacggacggctttgcatttatccgctgctgagggtcatttggcgtgcgtc
gaatttttgctcgctcaatgtggagtacctcatgacccgcgagatcgttggggcagtcga
cctctaaatgaagccgaaacatttggacacactgccgttgttcaatatctgaaggaatgg
gaacgcgctcaccccgaaaaccccccagtagaatcaccatcctcagtggacgaaatactc
gtgactaagccagatgctaccgatgctgtaaaggatcccagcatccaggagatagttacc
agaaatggagataaagtacaataa

DBGET integrated database retrieval system