KEGG   Bombyx mori (domestic silkworm): 101738927Help
Entry
101738927         CDS       T02817                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101738927
   00051 Fructose and mannose metabolism
    101738927
Enzymes [BR:bmor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     101738927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 416 aa AA seqDB search
MSSYSQPGAKRQKLRTEHVDYFQAIDKIQYNNMAAASDTASYRYYNSAERIHSKTMEEWL
KYSVSFSEFRNNGSDAHGRPTLSRQWDDNTDSVENHKRCVKALFDFCVKTGIKYWTAFDS
DLIPHSDNIEENKTYFDEMVECVQECSQRSHVKLLWIAPDLHSHPRYTSGAFTSNDAATF
AHAATQIKRCLEMSQRMNAECFLLWPYREGYDNVYHADVGREIKLFAKLMKITAEYKDRL
NYRCQLLMMPYYNSNMHTNDGCTYHSWQHRQWRETEMINMYMWDVTSCLYFLKHYNLDRY
YKVCSPPGHHMYMANVYNMLGGVFVTNAVDQCDSRRLTLMMKLIVEQGTPLPGGINLKLS
PRRDGDLRDYVTTYVKYVDAMARALRFACSLISEQILSKHLQVIIRFCKELIVGEW
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgtacagccagcccggagccaaacgacagaaactaaggactgagcatgtcgat
tactttcaagctatagacaaaatacagtataacaatatggcggctgcgtctgacactgca
agctacagatactacaacagcgcggagagaatacattccaaaaccatggaggagtggctt
aaatacagcgtgtccttttctgaatttagaaataacgggtcggatgcgcacggtcggccg
acactctcccgccagtgggacgacaacacggattccgttgaaaaccacaaacgatgcgtg
aaggccctattcgatttctgcgttaaaaccggcattaaatactggacggctttcgattca
gatttgataccacactctgataatattgaagaaaacaaaacgtattttgatgaaatggtg
gaatgtgtgcaggaatgttcgcagaggagtcatgtcaagttattatggatagctcctgat
ttgcactcgcatcccagatacacgtcaggcgccttcactagcaatgacgcggcaacattc
gcacacgcagcgacgcagataaagcgatgtctagaaatgtcacagcgtatgaacgcggag
tgcttcttgctatggccttacagggagggttatgacaatgtgtaccacgccgacgtgggt
agagagattaaattgttcgcgaaactcatgaaaatcacagccgagtataaagatagattg
aattacagatgtcaactattaatgatgccgtattacaattctaatatgcacacaaacgac
ggctgtacgtaccacagctggcaacacagacaatggcgcgaaaccgaaatgataaatatg
tacatgtgggatgtgaccagctgtttgtatttcctaaaacattacaatttagatcgttat
tacaaagtttgttcgccgcccggacaccacatgtacatggctaatgtatacaacatgcta
ggaggggtgtttgttacgaatgcggtcgatcagtgcgatagcaggcggctcacactcatg
atgaagttgattgtcgaacagggcacgccgcttcccggaggtatcaacctgaagctgtcg
ccccgccgggacggcgacctacgggactacgtcacgacatacgttaaatacgtcgatgcc
atggcgagggctctacgattcgcttgcagtttgatttctgaacagatactgtcgaaacat
ttgcaggtaattataagattttgtaaagaattgatagtaggggaatggtaa

DBGET integrated database retrieval system