KEGG   Bombyx mori (domestic silkworm): 101739342Help
Entry
101739342         CDS       T02817                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101739342
Peptidases [BR:bmor01002]
 Cysteine Peptidases
  Family C86
   101739342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 241 aa AA seqDB search
MSEMSAKPTIYHEKQIKELCALHALNNLFQTRGTFSKSELDAICSRLSPNVWINPHRSLL
GLGNYDINVIMAALQKKGCEAIWFDKRKDPGCLDLANICGFILNVPSDYKLGFVMLPLRR
RHWITIRQIQGNFYNLDSKLDSPQLIGRSCDLIAYLKEQLDSKEKELFIVVSKEVEEKQL
WMHQYVLPTPEPNYCPKLPLNGESPSESISSNGQYDYNNRDAECLKLNDVQNHILSTENN
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgagtgcgaaaccgactatttatcatgaaaaacaaataaaagaattgtgc
gccttacacgcgctcaataatttattccagactcgaggaacattttctaaatcggaacta
gatgcaatatgcagtcgcctgtctccaaatgtttggataaatcctcacagatcacttctt
ggccttggaaactatgatataaatgtgataatggcagcgttacagaagaagggctgtgaa
gccatctggtttgataaaagaaaagatcccggttgcctagatcttgccaatatttgtgga
ttcatattaaatgtgccttcggattacaagcttggttttgttatgctgccattacgtcgt
cggcattggatcacaattagacagatacagggaaacttttataatcttgattcgaagttg
gactcacctcagttaataggaaggagttgtgaccttatcgcgtatctaaaggaacaacta
gacagcaaagagaaagaactatttattgtggtgagtaaagaagtcgaagagaaacagctt
tggatgcaccagtatgttttgccaacaccggagccaaactattgccctaaactacctctg
aacggtgaaagtccaagcgaaagcatatcgtccaacggccaatatgattataataataga
gacgccgagtgtctcaaactaaatgatgtccaaaatcatatcctcagcacagagaataac
tgctaa

DBGET integrated database retrieval system