KEGG   Bombyx mori (domestic silkworm): 101739451Help
Entry
101739451         CDS       T02817                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101739451
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101739451
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101739451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 677 aa AA seqDB search
MDPMEVPVPDLEKLFERDGYLKPYEREIRRRYACYKDIWDRIESWDGGLEAFTKGYKYYG
PQFNQDGSVTWREWAPGAHSLHLRGEFNGWDSKSHPFAKKEYGKWEIQIPANPDGSCALK
HDSRVQIIVNDNLYRISPWASYVKPHEGFTYQHFIYKPEQPYKFKHPKVDKPRSLRIYEC
HVGIATSEGKVGSYNEFRENVLPRIKKQGYNAIQIMAIKEHAYYASFGYQVTSFFAASSR
YGTPCELKQLIDRAHEIGLYVLLDVVHSHASKNTLDGLNEFDGTNACYFHDGPRGTHSLW
DSRLFNYSEIEVLRFLLSNLRWYQEEYQFDGFRFDGVTSMLYHSRGIGEGFSGHYDEYYG
LNVDTEALIYLMLANDIVHSIDNRVITIAEDVSGMPASCRPVREGGTGFDYRLGMAIPDM
WIKLLKEEKDEDWKMGHIVHTLTNRRWMEGTIAYAESHDQALVGDKTIAFWLMDAAMYTH
MSTLSEPSAVVERGLALHCMIRLITHALGGEGYLNFIGNEFGHPEWLDFPRAGNNSSYHY
ARRQWHLVDDELLKYKFLNEFDRDMNHLEEKYGWLRSDPGFVSCKHEADKVIAFERAGLV
FVFNFHPYQSFTDYRIGVNVSGKYKAILCSDSKKYGGFGRVEPDGEFHSTQQIPWGNRND
SIQVYIPCRTAIVYAPT
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggatccgatggaagtgcctgtaccagatttagagaaattattcgaaagagacggttat
ttgaagccatacgaaagagaaattagaaggagatatgcttgctacaaagatatttgggac
cgtatcgaatcatgggacggtggcctagaagcattcacgaagggctacaaatactacgga
ccccaatttaatcaggatggctccgttacgtggcgcgagtgggctccaggagcgcatagc
ctacatcttcgaggagaattcaatggatgggactcgaagagccatccattcgctaaaaag
gagtacggcaaatgggagattcaaatccctgcaaatccagacggttcgtgtgcattgaaa
cacgactcccgtgtccaaatcatagtgaacgacaacttgtacagaatatcaccgtgggcc
agttacgtgaagccacatgagggttttacttatcaacattttatttataagccagaacag
ccctacaaattcaagcatccaaaggtagacaagccaaggtctcttcgcatctacgagtgt
cacgttggtatagcaacgtccgagggtaaagtgggctcttacaacgagttccgcgagaac
gtcctgcccagaatcaagaaacagggttacaatgctatacagatcatggccataaaggaa
catgcatattacgcttcgtttgggtatcaagttaccagcttttttgctgccagcagtcgt
tacgggactccttgcgaactaaaacagctgatagatcgggcacacgagataggtctatac
gttctactggacgtggtacattcgcacgcttcgaagaacactctagatggactcaatgag
tttgacggcacaaacgcttgctacttccacgacggacctaggggcacacactctttgtgg
gacagcagactgttcaattattccgagatcgaggttttgcgtttcctactatcaaacctg
cgatggtatcaagaagaatatcaattcgatggcttcaggttcgacggcgtgacgtcaatg
ttgtaccacagtcgcggtatcggtgaggggttctctggtcactacgacgaatattacgga
ctgaatgtagacaccgaggcactgatctacctgatgctcgccaacgacattgtgcacagc
atcgataacagagtcatcactattgctgaggacgtatctggtatgccagcgtcttgccgg
ccggttcgcgagggcggcaccggcttcgactaccgcctcggcatggccatcccggacatg
tggatcaagctgctcaaggaagagaaggatgaagactggaagatgggtcacatcgtgcac
accctcactaaccgacgttggatggaaggaactatcgcctacgccgaaagtcatgatcaa
gcgttagttggtgataaaacaatagcgttttggttgatggacgccgcgatgtacacgcac
atgagcaccctcagcgagcccagcgccgtggtggagcgcggcctcgccctacactgcatg
atacgactcatcacgcatgcgctcggcggagagggatatcttaactttatcggcaatgag
ttcggtcatcccgaatggctagacttcccgcgagccggtaacaactcgtcttaccactac
gccagacgtcaatggcacctcgtggatgacgaactcctcaagtacaagttcctcaatgaa
ttcgacagggatatgaatcatttggaggaaaagtacggctggttgagatctgatcctggc
tttgtgtcatgtaagcacgaagcggacaaagtgatagctttcgaacgtgcgggccttgtt
tttgtcttcaactttcacccgtaccagagctttacagattacaggattggtgtcaacgtg
tccggcaaatataaggctatactatgttcagatagtaagaaatatggaggttttggtcga
gtagagcctgacggagagttccattccacacagcaaataccatggggaaatagaaatgat
tcaatacaggtttacatcccttgccgtactgctattgtatacgcaccaacctaa

DBGET integrated database retrieval system