KEGG   Bombyx mori (domestic silkworm): 101739553Help
Entry
101739553         CDS       T02817                                 

Gene name
BmorQPVE2
Definition
(RefSeq) acyl-CoA desaturase-like
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101739553 (BmorQPVE2)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101739553 (BmorQPVE2)
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101739553 (BmorQPVE2)
Lipid biosynthesis proteins [BR:bmor01004]
 Desaturase
  First
   101739553 (BmorQPVE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 384 aa AA seqDB search
MTAVSENENLNNTTKLNSLLINSKYIGTDYSYKHEIVWKNAIGFLILHLLGLWGVGLMVT
GNIGLKSCLWTILYMYAGSTGVTVGAHRLFTHKSFKATPLLKVFLLCLQTIAGQNSTFIW
ARDHRLHHRYSDTDADPHNSKRGFFFCHIGWLMMKKHPYVIELGRTIDMSDLQADKMIMF
QKKYYYYLYFVVAFLIPVFVSIYFFNEHWLSSFLVCYCARYILQLNGTWLVNSAAHLYGT
RPYDRKLQPVESWFVSCISLGEGWHNYHHAFPWDYKAAEESMHFNCNATIIRFFERIGMA
YDLKTASPDMIRNRILRSGDGTHHVLGNDEAKSAVSAIGPLHPLNPTYNSTLKSPDAILK
PEGLPLFHENDVLINDIIRGNIAG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggttagcgaaaatgaaaatttaaataacactacaaaactgaatagtttgttg
attaactctaaatatataggaactgactactcatacaaacacgaaattgtatggaaaaac
gctatcggattccttattttacatttacttggcttgtggggagtcggactgatggtaact
ggtaatattggactaaaatcgtgtctttggactatcctatatatgtatgcggggagcaca
ggcgttacagtcggtgctcatcgactcttcactcataaatcattcaaagcaacaccgctt
ctcaaagtttttctcctttgcctacaaaccatagcaggacagaattcgacgttcatttgg
gctcgcgatcatcgtctccaccaccgctactccgataccgatgccgatcctcataattct
aagagaggcttcttcttttgccacatcggatggctaatgatgaaaaaacatccatatgtg
attgaattaggaagaacaattgatatgagtgaccttcaagcggataaaatgataatgttc
caaaagaagtactattactatttatactttgtggtggcatttctgataccagtattcgta
tctatctacttcttcaatgagcactggttgtcatcattcctcgtatgctattgtgctcga
tacattttacaattgaatggaacttggctggttaatagtgcggcgcacctgtacggcact
aggccatacgacaggaaactccagccggttgaatcctggtttgtgtcgtgtattagctta
ggcgagggctggcacaattaccaccacgccttcccgtgggactacaaggcagccgaggaa
tctatgcatttcaactgcaatgctactataataagattcttcgaacgaattggcatggct
tacgacttgaagacagcttctcccgatatgataagaaacagaattctgcgctccggtgat
ggaacccaccatgtgctgggcaacgatgaagccaagtcagcggtcagtgctattgggcct
cttcatcctctgaacccaacatacaacagcactttgaaatcccctgacgcaatcctcaag
cctgaaggcctcccgctgttccacgaaaacgacgttctcattaatgatataattagagga
aatattgctggataa

DBGET integrated database retrieval system