KEGG   Bombyx mori (domestic silkworm): 101739741Help
Entry
101739741         CDS       T02817                                 

Gene name
UGT42B1
Definition
(RefSeq) UDP-glucuronosyltransferase 2B14-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00040  Pentose and glucuronate interconversions
bmor00053  Ascorbate and aldarate metabolism
bmor00830  Retinol metabolism
bmor00860  Porphyrin and chlorophyll metabolism
bmor00980  Metabolism of xenobiotics by cytochrome P450
bmor00982  Drug metabolism - cytochrome P450
bmor00983  Drug metabolism - other enzymes
bmor01100  Metabolic pathways
Module
bmor_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101739741 (UGT42B1)
   00053 Ascorbate and aldarate metabolism
    101739741 (UGT42B1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101739741 (UGT42B1)
   00860 Porphyrin and chlorophyll metabolism
    101739741 (UGT42B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101739741 (UGT42B1)
   00982 Drug metabolism - cytochrome P450
    101739741 (UGT42B1)
   00983 Drug metabolism - other enzymes
    101739741 (UGT42B1)
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101739741 (UGT42B1)
Glycosyltransferases [BR:bmor01003]
 Others
  Hydrophobic molecule
   101739741 (UGT42B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_transf_4 Glyco_tran_28_C Glyco_trans_1_3 Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 101739741
NCBI-ProteinID: NP_001274756
UniProt: G9LPV7
Position
Un
AA seq 508 aa AA seqDB search
MKLIYLLLLLVTCYTDGLNILGIYPYQGKSHFFVFRVYLRELAKRGHNVTIISHFPEQDP
PANYHDISLAGTIKITEDNQSVRNSYWSVFSAAFYLAISGKENCQVMLANKQVQELIKSK
QKFDVVVVEQFNSDCALGVAYKLGAPAIGMSSHTLMPYHYKRLGIPYNPSYVPFHFLEGG
TKPSLFHRVERLFFDFFFRTFYYFVSQRSDQNTLAEYFDDIPPLEELARNMKFHLLYHNF
ILTGSRLFPSNVIEVGGYHVSNANPLTSDLKKFVDEAEHGIIFISFGSVIKSSTMTTDKV
EAILEVMKRMPQRFIWKWEDKSLIVDKNKLYVSHWLPQVDILGHPKTLAFLSHAGMGGIT
EAIHFGVPVVAMPFLGDQPANAADVEESGLGIQLQFRDLTTESLLNAFQTVLNTTFREKV
KKVSKAWHDRPMPPLETAIYWTEFVARNPDLNFRTAAADTPLYQYILLDVIAVLLTPLII
IFVALKRTRKSSAPIVKKTNGKKKSKKT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatttatttattactacttctcgttacatgctatacagacgggctcaatata
cttggaatatatccgtaccaggggaagagccattttttcgtattcagagtttatttacgc
gaattagctaagcgaggccacaatgttactattatttcacattttcccgaacaagatcca
ccggcaaactaccacgacatcagtctggcgggaacaatcaaaataacggaagacaaccaa
tccgttcggaattcttactggtctgtattcagtgccgctttctacctcgcaatttctggt
aaagaaaactgtcaagtaatgttagctaataaacaagtgcaagaactgatcaaaagtaag
caaaagtttgatgtggttgttgtcgaacagttcaacagtgattgtgcgttaggtgtagct
tataaactaggtgctccagcgatcggaatgtcctcacacacactaatgccttatcactat
aagagattaggcatcccctacaacccatcatacgtgccctttcatttcctggagggggga
actaagccatctctctttcaccgagtcgagagattgttttttgacttcttctttagaacg
ttttattactttgtaagccagcggagtgatcaaaacacactggctgaatattttgatgac
atccctccgctagaagaactggctaggaacatgaaatttcatctattgtatcacaacttc
attttaaccgggtcaaggctgttcccatccaatgtgattgaagtcggcggctatcacgtt
agcaacgccaatcctttaactagtgatttgaaaaaattcgttgatgaagctgaacatgga
attatattcataagttttggttctgttatcaagagctcaactatgacaacggataaagta
gaagctattttggaagttatgaaaagaatgccgcagagattcatatggaaatgggaagac
aaatcattaatagttgataaaaacaaattatatgtgtctcattggctgccgcaagttgat
attttaggacacccgaaaactttggcgtttctctcacatgcgggaatgggtggaattacc
gaggccattcattttggagtaccagtagtggccatgcctttcttgggcgatcagcctgct
aatgctgcggacgtcgaagagagcggtctaggaattcaattgcaattcagagatttaaca
actgagagcttattgaatgcgttccaaactgttttgaacaccacattccgtgagaaggta
aaaaaagtctcgaaagcatggcacgaccgaccaatgccccctttagaaacagcaatctac
tggaccgagtttgttgccaggaatccagatttgaattttagaacggctgcagccgacact
cctctataccaatatattctgcttgatgtaatagcagtgctattaacaccacttattatt
atattcgtcgcattgaaacgtacaagaaaatcttccgcgccaattgtaaaaaaaacgaac
ggtaaaaagaaatcaaagaaaacttga

DBGET integrated database retrieval system