KEGG   Bombyx mori (domestic silkworm): 101739798Help
Entry
101739798         CDS       T02817                                 

Definition
ubiquitin carboxyl-terminal hydrolase calypso-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
bmor  Bombyx mori (domestic silkworm)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 509 aa AA seqDB search
MKNMPVELNSLTEGWLELESDPGLFTLLLEDFGVKGVQVEEIYDLHKPLESPVYGFIFLF
RWIEERRSRRKFVEQIESFVRDEETINNIFFAQQMVPNSCATHALLSILLNCPNLHLGET
LSRLKHHTVGMNPENKGWAIGNTPELACAHNSHAIPQARKKTDKNAGVSTGRFTGEAYHF
VSLVPINGHLFELDGLKPYPMDHGPWAADEDWTDKFRRVMAERLGRDAGEQVHDIRFNLM
AVVPDRRLALTQKLGALEINQKRVKEAISKIGKHLRHLLGKGREYNGQSELITSNDIDTS
LNDSMVHISEETILTALQSSQLRTYDIDYTLPITIEIGAMDRPHQDSSILLVDPVEQGAV
VKFVTANKDSQIIGDIYPTSTTALVRSNESPVLLCSEIAPEQPYKLRKLLLSHSELNALM
SCIVGEVQSCQQALNDENDKRDMYKVDDCRRTHNYDEFICTFLSMLTERGALAELVAAQL
ERGRSPRVRRRRPRPRPRARPRPRPRGRK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatgccggtagaactaaacagtcttaccgaaggctggctagaattggaaagt
gatcctggtctttttactttactattagaagatttcggtgttaaaggtgtgcaagttgag
gaaatttatgacctgcataagcctttagagagcccggtgtacggatttatctttttattt
agatggatagaagagcgcagatcaaggcgaaaattcgttgaacaaattgaaagctttgta
cgggatgaggagaccatcaataatattttttttgcacagcaaatggtacccaacagttgc
gccactcatgctttactttccattttactaaactgtccaaatcttcatttaggagaaaca
ttaagtaggttaaaacatcatacagtgggtatgaatcctgaaaacaaaggatgggcaata
ggaaatacacctgagttggcttgtgcccacaactcacatgccataccacaagcacgcaaa
aagacagacaaaaatgctggagtttctactggcagatttacaggtgaagcataccatttt
gttagcttggtaccaatcaatggacatttgtttgaactagatggtcttaaaccatatcct
atggatcatggtccgtgggcagctgatgaggattggacagataaatttagaagggtaatg
gcagaaagacttggtagagatgcaggagaacaagttcatgatattagattcaacctaatg
gcagttgtaccagacagaaggttagcattaacacaaaagcttggggcacttgaaataaat
cagaagagagtcaaagaagctatttcaaaaatagggaaacatctacggcatttgttgggg
aaaggcagagaatacaacggtcagagcgagctcataactagcaatgatattgatacatct
cttaatgatagcatggtccacattagtgaagagacaatattaacagcattgcaatcatca
caactacgcacatatgacatagattacacactaccaattacaattgagattggtgctatg
gacagacctcatcaggatagcagtattttattagtggatcctgtggaacaaggagctgtt
gtgaaattcgttacagcaaataaagatagtcaaatcattggtgatatctatccaacatca
acaaccgccctagtgagaagtaatgaatcaccagttctattgtgctccgaaatagctccg
gaacagccctataagttgaggaaattgctcctttctcattcggaacttaatgcgctaatg
agctgcattgtcggtgaagtgcaatcgtgtcagcaggctctaaacgatgagaacgataaa
agagatatgtataaagtagacgattgtcgacgtacgcacaactacgacgagttcatctgc
actttcctatcgatgttgacggaacgtggagctctggccgaactggtcgccgcgcagtta
gaacgaggccggtctccgagagtgagacgacgacgtcctagacccagaccccgagcgcga
cctagaccaaggccacgtggaagaaaataa

DBGET integrated database retrieval system