KEGG   Bombyx mori (domestic silkworm): 101739974Help
Entry
101739974         CDS       T02817                                 

Definition
(RefSeq) histone acetyltransferase KAT7
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101739974
Chromosome [BR:bmor03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101739974
   HAT complexes
    HBO1 complex
     101739974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 727 aa AA seqDB search
MTNLDVSNSSTDSSSGSSSDSSSSDSTSTSSGSGSSSSDSESSTSDTPVTSTAPAPKSPT
KAKEPEKKEDDNPETTTKSKASSSSDDDVPKLESPKTLPPRRRCSAKPKTVAMVLAKGKT
ALRSSGAKTPKPAVKTGSKPKPETRDSNALKKKSIFSPDNSSESESESKSLKSPKESPRS
KRSSRKSSEEKVAPATPLGNDDSNSKDSKDSKDSVKRKNGNKANGPPSKKSPDNKSVSSC
SSSQSSIESVSSDSDSEPSTKKENGKTGKVKPNPTKQQEDVIKIDTLEATMPRKLTRSLS
ARVSRIAAATKINNTDTDSEVDEKEKGKDTKKPLKGRPGGKAERHFTWAACPLYHNVSGA
WCAAASEERAAAAAARRRALAHLSQRPRSMPTIEQRAYQLKVKDMRSKWKGSQELNEKLA
ASGNDELTEEREPILEGFAPDYDLRLFREAQALAAIKIEEELGEIITDRGTRFVVMGKYM
MEVWYQSPYPGAAARVPRLFVCEFCLAHQQSAAGAARHRDKCVWRHPPGDEVYRKDDLSV
WQVDGRKHKQYCQQLCLLAKFFLDHKTLYYDVEPFLFYVMTNADSEGCHIVGYFSKEKNS
FLNYNVSCILTLPPYQRQGYGRLLIDFRGAGGGDAAGGARAVRGAGVPALVGGRRRGRRG
GALTAAAARQQRGAGAALGRAGPAAPPLVACGAATGDESDSGARLLESAALVFHQQAAEL
RATTVVL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatctggatgtaagcaatagtagcacagacagcagctctggttcttcatcagac
tcgagcagcagtgacagtacatccaccagctctggctctgggtccagcagttctgattct
gagtcatcaacttctgacactcctgtaacctcaactgctccagcacctaaatctcctact
aaagctaaagaacctgagaaaaaggaagatgataatccagaaaccaccaccaagtctaag
gcctcatcttcaagtgatgacgatgtaccaaaattggagagcccaaagaccttacctcca
agaagacgctgttctgcaaaacctaaaacagtcgcaatggtacttgccaaaggtaaaacg
gcactgaggtcctcgggagctaaaacaccaaaaccagcagtaaaaactggatcaaaacca
aaaccagagacacgtgattctaatgcattaaagaaaaaaagcatcttctctcctgataat
agctcagaatctgaatcggaaagtaaatcattgaaaagccctaaagaatctccgagaagt
aaacgaagttcacggaagtcgagtgaggagaaagttgcccccgcaacaccattaggaaat
gacgattcaaattccaaagattctaaagactccaaagatagtgtaaagagaaaaaacgga
aacaaagcaaatggtccaccatcaaagaaatcaccagacaacaaaagtgtatcatcctgt
tcatcgagtcagtcctcaattgaatctgtatcttcagacagcgacagcgaaccatccacc
aaaaaagaaaatggtaaaactggaaaggtcaagccgaaccccactaagcagcaagaagat
gtaataaaaatagatacactagaagcaacaatgcctagaaagctaaccagatcactttcc
gcccgtgtttcacgtatagcagctgcaacaaagattaataacacagatacggattctgaa
gttgatgaaaaagagaaaggaaaagataccaaaaaacctctaaaaggcaggcctggtggc
aaggcggagcggcacttcacgtgggcggcgtgtccgctgtaccacaacgtgtcgggcgcg
tggtgcgccgccgccagcgaggagcgcgccgccgccgccgccgcccgccgccgcgccctc
gcgcacctctcgcagcggccgcgctccatgcccaccatagagcagcgagcctaccagctc
aaggtcaaggatatgcgttcgaaatggaagggcagtcaggagctaaacgagaagttggca
gcgtcgggcaacgatgagttgacggaagaaagggaaccgatattggagggcttcgctccc
gattacgatctgagattgttccgggaggcccaggccttggccgccatcaagatagaagaa
gaactcggtgaaataatcacagatagaggcactaggttcgtagtgatgggtaaatacatg
atggaggtgtggtaccagtcgccttaccccggggcggcggccagggtcccgcgcctcttc
gtctgcgagttctgtctggcgcaccagcagagcgccgccggggccgcgcgacaccgagac
aagtgcgtctggaggcacccgcccggagacgaggtgtacaggaaggacgatctcagcgtt
tggcaagtcgacggccggaagcacaagcagtactgtcagcagctgtgcctgctggccaag
ttcttcctcgaccacaagaccctgtactacgacgtggagccgttcctcttctacgtgatg
accaacgccgacagcgagggttgtcacattgtgggatatttcagtaaggaaaagaattcg
ttcctgaattacaacgtgtcgtgtatcttgacgctaccgccgtatcaaaggcaaggctat
ggcagattattgatcgacttcagaggtgctggaggaggcgatgcggcgggcggggcgcgc
gcggtgcgtggagccggcgtgcctgcgctggtgggcgggcggcggcgggggcggcggggc
ggcgcgctgacggcggccgcggcccggcagcagcgcggcgcgggcgctgctctagggcgc
gctgggcccgcagctccgccgcttgtcgcgtgcggcgctgcgaccggggacgagtccgac
tccggcgcccggctgctcgagtccgcagccctcgtgttccaccagcaggccgccgaactc
cgagcgacaaccgtcgtgctctag

DBGET integrated database retrieval system