KEGG   Bombyx mori (domestic silkworm): 101740216Help
Entry
101740216         CDS       T02817                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101740216
Peptidases [BR:bmor01002]
 Serine Peptidases
  Family S8: subtilisin family
   101740216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 626 aa AA seqDB search
MWLKCLTITVLFAATVSREVFTNSFLVRFKRSVRHDEATELAARHGFESLGPVLGSETEW
HFAHRGLPHARPRRSIAHTRILKQHPLVHTAVQQTGFKRVKRGYRPLRLPETVPASEPRD
PYFPLQWYLKNTGQNGGKPKLDLNVEAAWAQGYTGVNVTTAIMDDGVDYMHPDLKYNYNA
EASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGVCGVGVAYHSKVAGIRMLDQ
PYMTDLIEANSMGHEPHKIHIYSASWGPTDDGRTVDGPRNATMRAIVRGVNEGRNGLGNI
YVWASGDGGEDDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGARDPS
TGVATTDLYGKCTATHSGTSAAAPEAAGVFALALHANPNLTWRDIQHLTVLTSKRNSLYD
AKGRFHWTMNGVGLEFNHLFGFGVLDAGAMTALAANWRSVPPRYHCEAGSVNTHTEIPTD
GSVTLKIDTTACAGSPSEVRYLEHVQAVVSANGTRRGDLEFFLTSPMGTRSMILSRRAND
GDSRDGFTKWPFMTTHTWGEYPQGTWILEARYNGGGSSGGEWSGWVRGWSLVLHGTRAPP
YAQLQPQDPHSKLAVVKKAHEDALAK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgaaatgcttgactataaccgtgcttttcgcggcgaccgtttcccgagaagtc
ttcacgaattccttcctggtgcggttcaagagatcggtccggcatgacgaggctacggag
ctggccgcccgccacggcttcgagagtcttggaccggtactaggttctgagacggaatgg
catttcgcgcatcgcggcttgccacacgctcgtccaaggcgttcgatcgcgcacacaagg
atcctgaaacagcatccattggtacacactgcagtccagcagactggtttcaaacgcgtc
aaaagaggatatcgtcctctgcgcctgccggagacagtaccggcctctgagccccgtgat
ccctactttccgctgcagtggtacctgaagaacacgggacaaaacggcgggaaacccaag
cttgatctgaacgtggaagcagcttgggctcaagggtacactggcgtcaacgtaaccaca
gctatcatggatgatggtgtcgattacatgcatcccgacttaaaatataattacaatgcg
gaggcttcgtacgacttcagcagcaacgatccgtttccttatccacgctacacggatgac
tggtttaacagtcacggaacgaggtgcgctggtgaagtggccgcagctcgcgacaacggc
gtctgtggtgtcggcgtcgcttatcactccaaagttgccggtataagaatgttagaccag
ccgtacatgacagatctcatcgaagccaattctatgggtcatgagccccacaagattcac
atatacagtgcctcgtggggtcctacagacgacggtcgtactgtagatggaccaagaaac
gcgactatgagagctattgtgagaggagttaatgagggtcgtaatggcctcggtaatatc
tacgtatgggcgagtggtgatgggggcgaggacgacgattgcaattgtgatggctacgct
gcgtctatgtggactatttcaattaatagtgcaataaatgacggtcaaaacgcgcattac
gacgaatcatgttcgtctacgctcgcgagcacattcagcaatggtgctcgcgatcctagt
actggagtggcgaccactgatttgtacggaaaatgtactgcgacccactcggggacatca
gctgcggcgccagaagctgctggggtattcgctctggctttacatgccaatccgaatctg
acgtggcgcgacatccagcatctaacagtattgacttcgaaaagaaattcgctgtacgat
gcaaagggacgttttcactggactatgaatggagtgggcttagaattcaatcacttgttc
ggttttggggtactggacgccggtgcgatgaccgctctggctgctaattggcgctccgtg
cctccgagatatcattgtgaagcaggatctgttaatactcacaccgagatcccgaccgat
ggcagcgtgaccttgaagatcgacaccacagcatgcgcgggctcccccagcgaggtgcgc
tacctggaacacgtgcaggccgttgtcagcgccaacggcacgcgacgcggcgacctggag
ttcttcctcaccagtccaatgggaaccagatccatgattttaagcagacgggccaacgat
ggcgactcccgggacggcttcacaaagtggcccttcatgaccacacatacatggggagaa
tatccacagggcacatggatcctagaggctcggtacaacggtgggggctcgtcgggggga
gagtggtccggctgggtgcgcggctggtcgctagtgctgcacggcacgcgcgcgccgccc
tacgcccaactccagcctcaggacccgcactccaagctcgccgtcgtcaagaaagcacac
gaggacgcgctcgccaagtaa

DBGET integrated database retrieval system