KEGG   Bombyx mori (domestic silkworm): 101740289Help
Entry
101740289         CDS       T02817                                 

Definition
histone acetyltransferase Tip60-like
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101740289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MNENDDELTTFCDSTSSLVEGCRLPVRMQGGDDWPLAEIISIKEVQGQRGFYVHYVDFNK
RLDEWVGESWLDTRKVQFPRRDGTATGGTTTPKKTLIGSGGGVMPTFINDTVCNENQKSS
NARTITNQLTQPKTHEKAHFSNALNGSAQKNALAVVEPRQLVSRPASPTLVNDSSSLVNG
GAVLAAALQKKMNRKRKPPSLDNDVSLHSEPSQEGEADATASGTATPTARPRQSGSLVAH
GHDDLVTRMKNIEMIELGRHRIRPWYFAPYPQEMVNLPCIYICEFCLKYRKSKKCLERHL
IKCKLKHPPGNEIYRKGSISFFEIDGRKNKCYAQNLCLLAKLFLDHKTLYYDTDPFLFYV
MTEFDSRGFHIVGYFSKEKESTEDYNVACILTLPPYQRKGYGKLLIEFSYELSKFEGKTG
SPEKPLSDLGLLSYRSYWAQTILDILLHIKPVGDNEKPVITINEICELTSIKKEDVISTL
QNLNLINYYKGQYIISVNQETLQQHEKAMEKRMLRIDPKCLHWTPKDWSKRAKCV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatgatgatgaattgacaacattttgtgattcaacgtcatcgcttgttgag
ggatgccgtcttcctgttcgtatgcaaggaggagacgactggccactcgccgaaattata
agtattaaagaagttcagggccaaagaggattttacgtgcattatgttgattttaataaa
cgtctcgatgaatgggtgggtgaatcttggttggacactcgtaaagtccaattccctcga
cgggatggaacagcaacaggtggtacaactactccaaagaaaacactcattggatcagga
ggtggcgttatgcctacttttattaatgacacagtctgcaatgagaatcagaagtctagt
aatgctagaactataacaaatcaactgacccaacccaaaacacatgaaaaggcccatttt
agcaatgcactcaatggttccgcacaaaaaaatgcacttgctgtggttgaaccaagacag
ttggtgtcccgacccgccagtccgactctggtaaatgattcttcgtcactggtcaatgga
ggagctgtcctcgcagcagccttacagaaaaagatgaacagaaaacgcaaaccgccctct
ttggataatgacgtcagtttacattcggagccgtcacaagaaggtgaagcggacgcgacg
gccagcggcacggcgacgccgacggcgcgcccgcgacagtccggcagtctggtcgcgcac
ggacacgacgatctcgtcacgcggatgaagaacatcgagatgatagaactgggacggcac
aggatacgaccttggtacttcgcgccatacccccaggaaatggtgaatctcccttgcata
tacatctgtgagttctgtttgaaatataggaaaagcaaaaaatgcctcgaaagacacttg
atcaaatgcaaactaaaacatccgccgggcaacgagatttaccgcaagggaagcatatcg
ttcttcgagatagacggacgcaagaacaaatgctacgcgcagaacttgtgtctcttagct
aaattatttctggaccacaaaaccttgtactacgatacagaccctttcttgttttacgtc
atgaccgaattcgattccagaggattccatatagtgggatatttttcgaaggaaaaagaa
agcacggaagactacaacgtagcatgtatactgacactgcctccgtaccaaagaaagggc
tatggaaaattactcatagaatttagttacgaattgtcaaagttcgaaggtaaaacgggc
tctccggagaaaccgctgtcggacctaggactgttatcatacagaagttattgggctcaa
accatactcgatatattattgcacatcaaacctgtaggcgataatgaaaaaccggtaatt
accataaatgaaatttgcgaactgactagcattaagaaggaggacgtgatcagtacattg
cagaatttgaacctcatcaactactacaagggacagtacattatctcggtcaaccaggaa
actcttcagcaacacgagaaagcaatggaaaaacgtatgctaagaatcgatccaaaatgt
ttacactggactccaaaagattggtctaaacgggcgaaatgtgtttga

DBGET integrated database retrieval system