KEGG   Bombyx mori (domestic silkworm): 101740744Help
Entry
101740744         CDS       T02817                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101740744
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101740744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MAAILGGGLGGLSTGYYLLKNNLNSNNNLKLYLLEATNYCGGWIKSIRTKDYVFEQGPRT
IRPKGVTGLNTLNMIQDLGLSEHISPIKPDHPAARNRMIYVNNNLYLLPSSLKGVFQKNE
PFSKPLIYALYHDLKKPHKQLKDDSIYNFVERRFGKEIADYAISPMICGICAGDAKEISV
KFLMKTLFEWEQTHGGVVKGLMKSLFSSKTGNELVLSDLARKAQEEKWSVYTIKGGLEMF
PNKLQAHLKDNNVTMNLSTKVEAIEFVDSGSVSLNIQTGEKLSVNHVYSSIPAYCLASLV
QKQHPELAKTLKDIPFVTVGIVNLYFATQKPLIKPAFGFLVPPIENSPILGVVFDSCCMP
DQNGTVLTVMLGGRWFEEKFGKNTTSENLYNIAVKEVGSILDIKDKPTAFNVNILNRCIP
QYVVGHYERVDEIRQYIKSNNLPISLIGSSYDGVGINDVIYSAKSQVEET
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggccgctatacttggcggtgggctgggtggtctctctacaggctattatttgctcaaa
aacaatttaaattctaacaataatttaaaactgtaccttctagaggctactaattactgc
ggcggatggattaaatccataaggacaaaggattacgtttttgagcaaggcccaagaact
atacggcccaaaggagttaccgggcttaatacactgaatatgatacaagatttgggcctt
agcgagcatatatcacctataaaaccggaccaccctgccgctaggaacagaatgatatac
gtaaacaataatttgtatttattgccttcaagtttaaaaggtgtattccaaaagaatgag
cccttttcgaagccgctgatttacgcactttatcacgatttaaagaagcctcacaaacag
ttgaaagatgattcgatttataacttcgttgaaaggagattcgggaaggaaattgctgat
tatgcaatttcaccaatgatttgtggcatctgtgctggggacgctaaagagatttcagtt
aaatttttaatgaaaactctatttgaatgggagcaaacccacggaggcgtcgtaaaaggt
ttgatgaagtcattgttcagttcgaagactggaaatgaattagtactaagtgatttagca
aggaaggctcaggaagaaaaatggagtgtttacacgataaaaggtggcttggaaatgttt
cccaacaaactgcaagcccacttaaaagataacaatgtaaccatgaacttgagtacaaaa
gttgaagccatagaatttgtggactctggatctgtttcgttaaatattcaaacaggagaa
aagttatcagtgaatcatgtgtattcttcaataccagcttattgtctagcaagcttagta
caaaaacagcatccagaattagctaaaacactaaaagatataccatttgtaactgtggga
atagtaaatttgtattttgccactcaaaaacctttgataaagccggcatttggtttctta
gttcctccgattgaaaattctcccatattaggtgtagtctttgattcgtgttgtatgcca
gatcaaaatggaactgttttaacagtgatgcttggaggcagatggtttgaagaaaaattt
ggaaaaaatacaacatcggagaatttatataacattgctgtcaaagaagtaggttcgata
ttggatattaaagacaaaccaacagcatttaatgtgaatattttaaatagatgcatacct
cagtatgtagtaggacattatgagagagttgatgagattagacaatacataaaaagtaat
aatttgccaatttctttaataggcagcagttatgatggtgtaggtataaatgatgttatt
tattctgcaaaaagtcaagttgaagagacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system