KEGG   Bombyx mori (domestic silkworm): 101741037Help
Entry
101741037         CDS       T02817                                 

Definition
(RefSeq) acyl-CoA desaturase-like
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor01040  Biosynthesis of unsaturated fatty acids
bmor01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101741037
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101741037
Lipid biosynthesis proteins [BR:bmor01004]
 Desaturase
  First
   101741037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Acetyltransf_13
Motif
Other DBs
NCBI-GeneID: 101741037
NCBI-ProteinID: XP_004933820
Position
Un
AA seq 172 aa AA seqDB search
MFIFSGLGITCGVHRLWTHRSYKVKAPVKFLLMAFFCSSGQNSIYNWVRDHRLHHKFADT
DADPHNVNRGFFFSHIGWLMMKKNESVLTKGKLIDMSDIESDSHLMFQHKYHNQLKILFC
FLIPTLVNIFLIGEDWKCAVAWQCFIRFLCVLHSELTVNSLAHMYGYKPYNV
NT seq 515 nt NT seq  +upstreamnt  +downstreamnt
atgtttattttctctggattaggtattacttgcggtgtgcataggttgtggacgcatcga
tcgtacaaagtcaaagcacccgtaaagtttctcttgatggctttcttctgcagcagtggc
cagaattcaatatacaactgggtgagggatcacagactccatcacaagttcgccgacacc
gatgccgaccctcacaacgtgaaccgaggcttcttcttctcccacataggatggctgatg
atgaagaaaaacgaaagcgtccttacgaaaggaaagctgattgacatgagtgacatagag
agcgattcccatttgatgtttcaacataaataccacaatcaattaaaaatcctattctgt
tttctaataccaacattggtgaacatcttcttgatcggggaagattggaagtgcgctgtt
gcctggcaatgcttcatacggttcctttgcgtgctacactctgaactgactgttaatagt
ttggctcatatgtacggctataaaccttacaacgt

DBGET integrated database retrieval system