KEGG   Bombyx mori (domestic silkworm): 101741052Help
Entry
101741052         CDS       T02817                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101741052
Peptidases [BR:bmor01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101741052
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101741052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 374 aa AA seqDB search
MFDLTGICILVPLYTAGILLLGATITSGVFVFHVAVVPLIFKYSKSFRRNLVFANFVQWP
LNVNFEEPSSSGIEGGRNLSVEYHSKVDNCPIKIGIWHILPRTSYERLKGNFDVDSDKEE
LNRIMDHELATSKTPIMLYCHGNSNSRAASHRIQLYKFFQKMDFHTIAFDYRGYGDSTNL
CPTEEGVVEDALVVYDWLLATADKGGETPPVFVWGHSLGTAISAHLLGNLEQLSLRVLGR
ALPPPRGLVLEAPFNNLADEVAKHPLSKLVTWLPYYEATFVEPFRVHPEQRFQSERHLGG
APGLPVLILHARDDVVVPFAVGLQLYKSILASRSQGGATVALHAYEKSENLGHKWICEAK
DLTQVIGDFVTAHL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatttgaccggtatttgtattttagtgcccctttatacagctggaatactgctg
cttggtgcaacaataacgtccggagtgttcgttttccacgtagctgttgtaccactaata
ttcaaatattcaaaatcatttaggaggaatctagtctttgctaattttgtacaatggcct
ctgaatgtgaacttcgaagaaccctcgtcaagtggtatagagggcggcaggaatctgagc
gtggagtatcattcaaaagttgacaattgtccaatcaaaataggtatatggcatatccta
ccgagaacaagctatgaaagattgaaaggaaatttcgatgttgattcagacaaggaggaa
ttaaatagaataatggatcatgaattggctacgtccaaaactccaataatgctttattgc
cacggaaattcaaattcgcgcgccgcctctcacagaatacagctgtataagttctttcag
aaaatggatttccacaccatcgcttttgattacagaggatatggcgattccacgaacctg
tgtccgactgaggagggcgtcgtggaagacgcactggtcgtctacgactggcttctggcc
accgcagacaagggtggggagacgccgcctgtattcgtatggggacactctttgggaacg
gcgatatcagcgcacctcctcggcaacttggagcagctctcgcttcgggtcctgggccgc
gccctgccgccgccccgcgggctcgtgctggaggcgcccttcaacaacttagcggatgaa
gtagcgaagcacccactgtccaagctggtgacgtggctgccgtactacgaggctaccttc
gtggagcccttcagggtccaccccgagcagaggttccagtctgagaggcacctgggtggg
gccccagggctacccgtgctcatactgcacgccagggacgacgtcgtggtgcccttcgcc
gtcggactccagttgtacaaatcgatactagcttcgcgctcgcaaggtggcgccaccgtc
gcgttacatgcctacgagaaatccgagaacctgggccacaagtggatatgcgaggccaaa
gacttgacccaagttataggagatttcgttacggctcatctatga

DBGET integrated database retrieval system