KEGG   Bombyx mori (domestic silkworm): 101741278Help
Entry
101741278         CDS       T02817                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bmor00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:bmor04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bmor04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bmor04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bmor04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1055 aa AA seqDB search
MVPAPSCPNTWDYWMSPQSDCVELTCLLPNSMYIPLRKSWDATFEDVKEDLWDRAVNYPL
FGMLLEMNKYIFQFVNSLAVTEELDDERKRICDIKPVCGVLIIVKRSDGRPAEDCLNRDI
THLIGKSLKVFDSLKNSEVNDYRMRMRYLAEESLLKRTHSTTLERLRYQCPLRLADQPEI
PTTLKSHLNDQRFILVTKVMEITSYSSNVPATLTPQQHIEIVLRKLNNSMNLRSEHPHNY
VLKVCGREEYLFGDYPLIQFLYIQEMLAVDGVPQVMTVSIDKLRLSLDREIPYMPERRRL
TSEHSNTMRRKKNESSWNIQKNYTCRVQSACGLNVDPSRVVEVVCLGGIFHGGKPLCEVQ
KTKVAVISKEGVATWDEELTFPIKVHNLPRMARLCFGIYELSKIKSKWRGKDKEPVNRLT
WANTMVFDYQEQLRTDGVRLAMWTHVADDTQGDDMVLHPLGTVVANPTPDSAVLQVMFSN
YDCQYPILFPKQETVMAYSDHIESVSPDLMDRLCRDFERLRIIAEKDPMYEMHEQEKKDI
WASRERFRVETPELLPKLLSCVEWGERTQASSVPRMLDEWPLLRVESALELLDYAYADAA
VRSFAVKCLEKISDNDLMLYLLQLVQALKHESYLMCDLSVFLLQRAFKNMTIGHYLFWHL
RSEMHVPSVSVRFRLMLEAYCRGSQEHIKILKQQITCLEKLKWVNQCVKEKKEISKARIA
LHQHLQEKHCVDALCEGFVSPLNPSFKCKRIKPEGCRVMDSKMRPLILNFENFDPTGNDI
RIILKIGDDLRQDMFTLQMLRIMDRLWKNHGYDFRLNAYNCISIEYSVGMIEVVEDAETV
ANIQKQNAPFNAASTINKAALLQWLRKYTDNNNENAFNKAIDEFTMSCAGYCVATYVLGI
ADRHPDNIMVKKSGQLFHIDFGHFLGHFKQKYGFKRERVPFVLTHDFIYVINKGQKGSGD
NNAIDFKIFKEHCETAFKILRKHGHLILSLFSMMISTGLPELSSEKDLQYLRDTLVMDRS
EEKAMEHFREKFSDALKNSWKTSFNWVFHNCDKNN
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgcgccgagttgtcccaatacgtgggactactggatgtccccgcagtccgat
tgcgtagaacttacgtgcctgctcccgaattcaatgtacatacccctacgaaaaagttgg
gatgcaacttttgaggatgtcaaagaggatctttgggacagagcagtcaattatccttta
ttcggaatgttgcttgaaatgaacaaatatatttttcaattcgtaaactcattagctgtc
acagaagaattagatgatgaaagaaaacgtatatgtgacatcaaacctgtatgtggtgtg
cttattatagttaaaaggtcagatggtagacctgccgaagactgccttaacagagacatc
acacatttgataggaaaatccctaaaagtatttgatagtctaaaaaattcagaagtgaac
gattatcgaatgcgaatgcgctatctggccgaggagagtttgttgaaacggacgcacagc
accacgctcgaacgtctccggtatcagtgtccgctgcggctggccgatcagcccgagatc
ccgacaacactgaagagtcatcttaatgaccagcgtttcatactcgttaccaaagttatg
gagataacctcgtactcatcaaacgtgccggccacgttgactcctcagcaacacatcgaa
atcgtgcttcgaaagttgaacaactccatgaatttgaggtcggaacatcctcacaactac
gttctcaaagtgtgcggccgtgaggagtacctattcggggattatcctttgatacagttt
ctatacatacaagagatgctggccgtagacggagtgcctcaagttatgaccgtcagtatt
gataaattgcgtttatccttggatcgtgagataccatatatgccggaacgcagaagactt
acatcggaacattcgaacactatgcgaagaaagaaaaacgaatcgtcttggaacattcag
aagaattacacttgccgcgtgcaaagcgcttgcggactcaatgtggacccaagcagagtg
gtcgaggttgtctgtttaggcgggatatttcacggcggcaagccgctatgcgaagtacaa
aagacaaaagttgctgtaatatcgaaagaaggtgttgccacatgggacgaagagttgaca
tttccgataaaagttcacaacttaccgcgaatggcgagactgtgtttcggtatttacgaa
ctatcaaagattaaatcgaaatggagaggaaaggataaggagccggtgaatcgattgacg
tgggccaacacaatggtgttcgattaccaggagcagctgcgcacggacggcgtgcggctc
gcgatgtggacgcacgtggcggacgacacgcagggcgacgacatggtgctgcacccgctc
ggcaccgtcgtcgccaaccccacgcccgactccgccgtgctgcaggtcatgttctccaat
tacgactgccaatatcctatcctattcccgaagcaagagacagtgatggcttactcggac
cacatcgagagcgtctccccggacttgatggacagactgtgcagagactttgaacgctta
cgtataatagccgagaaagatcctatgtatgaaatgcacgagcaagagaaaaaagatatt
tgggcttcgagagaacgctttcgagtggaaacgcccgagctactgccaaagttattgtca
tgcgttgagtggggtgaacgaactcaggcctccagcgtgcccaggatgttggacgagtgg
cctctgttgcgggtggagtctgccttagagctgttggactacgcgtacgctgatgcagca
gtcaggagttttgctgtcaaatgtttggaaaaaattagtgataacgatctcatgctgtac
ctcctccagttggttcaagccctgaagcacgagtcctacctcatgtgtgacctgtccgtg
ttcctcctgcagcgagccttcaagaatatgaccattggacactatttattttggcattta
aggtcggagatgcacgtgccgtccgtgtccgtgcgcttccggctgatgctcgaggcgtac
tgccgcggctcgcaagagcacatcaagatactcaagcaacagatcacgtgtctggagaaa
cttaaatgggtgaatcagtgtgttaaagagaaaaaggagatatctaaagcccgaatcgcg
ttacaccagcacttacaagagaaacactgcgtcgacgctctctgcgagggattcgtgtcg
ccgctcaaccctagcttcaagtgtaaaagaatcaagcctgaaggttgtcgagtcatggac
agtaaaatgcgtcctctgatattgaattttgagaatttcgacccgaccggcaacgatatc
cggataatattgaaaataggagacgatctcagacaagatatgttcacgctacagatgctg
aggataatggatagattatggaaaaatcatggatacgacttcagactgaacgcgtacaac
tgcatatcgatcgagtattctgtcggcatgatcgaggtggtggaggacgcggagaccgtc
gccaacatacagaagcagaacgcacccttcaacgcggcgtccactataaacaaagcggcc
ttgctgcaatggcttcgaaagtacaccgacaacaacaacgagaacgccttcaacaaggcg
atcgacgagttcacgatgagctgcgccggctactgcgtcgccacctacgtgctgggcatc
gccgaccgacatcccgacaacatcatggtcaagaagagcgggcagctcttccacatagac
ttcggccatttccttggacatttcaaacagaagtacggattcaaacgggaaagggtgccc
tttgtgctgacgcacgattttatatacgtcatcaataaaggtcagaagggctccggcgat
aacaacgctatcgacttcaaaatattcaaggagcattgcgaaactgcattcaaaatcctc
cgcaaacatggacatctaatactgtcgttgttctcaatgatgatatcgacggggctgccg
gaactcagctcggagaaggacttgcaatacctcagagatacattagtaatggatcggtcc
gaagagaaagcgatggagcatttccgtgagaagttctcggacgccctcaagaattcgtgg
aagacatccttcaactgggtcttccataactgcgacaagaacaactga

DBGET integrated database retrieval system