KEGG   Bombyx mori (domestic silkworm): 101741278Help
Entry
101741278         CDS       T02817                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101741278
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101741278
   04070 Phosphatidylinositol signaling system
    101741278
   04150 mTOR signaling pathway
    101741278
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    101741278
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101741278
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101741278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1055 aa AA seqDB search
MVPAPSCPNTWDYWMSPQSDCVELTCLLPNSMYIPLRKSWDATFEDVKEDLWDRAVNYPL
FGMLLEMNKYIFQFVNSLAVTEELDDERKRICDIKPVCGVLIIVKRSDGRPAEDCLNRDI
THLIGKSLKVFDSLKNSEVNDYRMRMRYLAEESLLKRTHSTTLERLRYQCPLRLADQPEI
PTTLKSHLNDQRFILVTKVMEITSYSSNVPATLTPQQHIEIVLRKLNNSMNLRSEHPHNY
VLKVCGREEYLFGDYPLIQFLYIQEMLAVDGVPQVMTVSIDKLRLSLDREIPYMPERRRL
TSEHSNTMRRKKNESSWNIQKNYTCRVQSACGLNVDPSRVVEVVCLGGIFHGGKPLCEVQ
KTKVAVISKEGVATWDEELTFPIKVHNLPRMARLCFGIYELSKIKSKWRGKDKEPVNRLT
WANTMVFDYQEQLRTDGVRLAMWTHVADDTQGDDMVLHPLGTVVANPTPDSAVLQVMFSN
YDCQYPILFPKQETVMAYSDHIESVSPDLMDRLCRDFERLRIIAEKDPMYEMHEQEKKDI
WASRERFRVETPELLPKLLSCVEWGERTQASSVPRMLDEWPLLRVESALELLDYAYADAA
VRSFAVKCLEKISDNDLMLYLLQLVQALKHESYLMCDLSVFLLQRAFKNMTIGHYLFWHL
RSEMHVPSVSVRFRLMLEAYCRGSQEHIKILKQQITCLEKLKWVNQCVKEKKEISKARIA
LHQHLQEKHCVDALCEGFVSPLNPSFKCKRIKPEGCRVMDSKMRPLILNFENFDPTGNDI
RIILKIGDDLRQDMFTLQMLRIMDRLWKNHGYDFRLNAYNCISIEYSVGMIEVVEDAETV
ANIQKQNAPFNAASTINKAALLQWLRKYTDNNNENAFNKAIDEFTMSCAGYCVATYVLGI
ADRHPDNIMVKKSGQLFHIDFGHFLGHFKQKYGFKRERVPFVLTHDFIYVINKGQKGSGD
NNAIDFKIFKEHCETAFKILRKHGHLILSLFSMMISTGLPELSSEKDLQYLRDTLVMDRS
EEKAMEHFREKFSDALKNSWKTSFNWVFHNCDKNN
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgcgccgagttgtcccaatacgtgggactactggatgtccccgcagtccgat
tgcgtagaacttacgtgcctgctcccgaattcaatgtacatacccctacgaaaaagttgg
gatgcaacttttgaggatgtcaaagaggatctttgggacagagcagtcaattatccttta
ttcggaatgttgcttgaaatgaacaaatatatttttcaattcgtaaactcattagctgtc
acagaagaattagatgatgaaagaaaacgtatatgtgacatcaaacctgtatgtggtgtg
cttattatagttaaaaggtcagatggtagacctgccgaagactgccttaacagagacatc
acacatttgataggaaaatccctaaaagtatttgatagtctaaaaaattcagaagtgaac
gattatcgaatgcgaatgcgctatctggccgaggagagtttgttgaaacggacgcacagc
accacgctcgaacgtctccggtatcagtgtccgctgcggctggccgatcagcccgagatc
ccgacaacactgaagagtcatcttaatgaccagcgtttcatactcgttaccaaagttatg
gagataacctcgtactcatcaaacgtgccggccacgttgactcctcagcaacacatcgaa
atcgtgcttcgaaagttgaacaactccatgaatttgaggtcggaacatcctcacaactac
gttctcaaagtgtgcggccgtgaggagtacctattcggggattatcctttgatacagttt
ctatacatacaagagatgctggccgtagacggagtgcctcaagttatgaccgtcagtatt
gataaattgcgtttatccttggatcgtgagataccatatatgccggaacgcagaagactt
acatcggaacattcgaacactatgcgaagaaagaaaaacgaatcgtcttggaacattcag
aagaattacacttgccgcgtgcaaagcgcttgcggactcaatgtggacccaagcagagtg
gtcgaggttgtctgtttaggcgggatatttcacggcggcaagccgctatgcgaagtacaa
aagacaaaagttgctgtaatatcgaaagaaggtgttgccacatgggacgaagagttgaca
tttccgataaaagttcacaacttaccgcgaatggcgagactgtgtttcggtatttacgaa
ctatcaaagattaaatcgaaatggagaggaaaggataaggagccggtgaatcgattgacg
tgggccaacacaatggtgttcgattaccaggagcagctgcgcacggacggcgtgcggctc
gcgatgtggacgcacgtggcggacgacacgcagggcgacgacatggtgctgcacccgctc
ggcaccgtcgtcgccaaccccacgcccgactccgccgtgctgcaggtcatgttctccaat
tacgactgccaatatcctatcctattcccgaagcaagagacagtgatggcttactcggac
cacatcgagagcgtctccccggacttgatggacagactgtgcagagactttgaacgctta
cgtataatagccgagaaagatcctatgtatgaaatgcacgagcaagagaaaaaagatatt
tgggcttcgagagaacgctttcgagtggaaacgcccgagctactgccaaagttattgtca
tgcgttgagtggggtgaacgaactcaggcctccagcgtgcccaggatgttggacgagtgg
cctctgttgcgggtggagtctgccttagagctgttggactacgcgtacgctgatgcagca
gtcaggagttttgctgtcaaatgtttggaaaaaattagtgataacgatctcatgctgtac
ctcctccagttggttcaagccctgaagcacgagtcctacctcatgtgtgacctgtccgtg
ttcctcctgcagcgagccttcaagaatatgaccattggacactatttattttggcattta
aggtcggagatgcacgtgccgtccgtgtccgtgcgcttccggctgatgctcgaggcgtac
tgccgcggctcgcaagagcacatcaagatactcaagcaacagatcacgtgtctggagaaa
cttaaatgggtgaatcagtgtgttaaagagaaaaaggagatatctaaagcccgaatcgcg
ttacaccagcacttacaagagaaacactgcgtcgacgctctctgcgagggattcgtgtcg
ccgctcaaccctagcttcaagtgtaaaagaatcaagcctgaaggttgtcgagtcatggac
agtaaaatgcgtcctctgatattgaattttgagaatttcgacccgaccggcaacgatatc
cggataatattgaaaataggagacgatctcagacaagatatgttcacgctacagatgctg
aggataatggatagattatggaaaaatcatggatacgacttcagactgaacgcgtacaac
tgcatatcgatcgagtattctgtcggcatgatcgaggtggtggaggacgcggagaccgtc
gccaacatacagaagcagaacgcacccttcaacgcggcgtccactataaacaaagcggcc
ttgctgcaatggcttcgaaagtacaccgacaacaacaacgagaacgccttcaacaaggcg
atcgacgagttcacgatgagctgcgccggctactgcgtcgccacctacgtgctgggcatc
gccgaccgacatcccgacaacatcatggtcaagaagagcgggcagctcttccacatagac
ttcggccatttccttggacatttcaaacagaagtacggattcaaacgggaaagggtgccc
tttgtgctgacgcacgattttatatacgtcatcaataaaggtcagaagggctccggcgat
aacaacgctatcgacttcaaaatattcaaggagcattgcgaaactgcattcaaaatcctc
cgcaaacatggacatctaatactgtcgttgttctcaatgatgatatcgacggggctgccg
gaactcagctcggagaaggacttgcaatacctcagagatacattagtaatggatcggtcc
gaagagaaagcgatggagcatttccgtgagaagttctcggacgccctcaagaattcgtgg
aagacatccttcaactgggtcttccataactgcgacaagaacaactga

DBGET integrated database retrieval system