KEGG   Bombyx mori (domestic silkworm): 101741392Help
Entry
101741392         CDS       T02817                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101741392
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101741392
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101741392
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101741392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 477 aa AA seqDB search
MAYTSTNDGLRFSKSQGQVTHDEQFDASVAEKHESLPKEFDFFTTGVVLRVDSTIKFQTI
EGFGGAVTDAASLNWRKLPPAAQDKLIETYFGPNGLEYNMMRVPIGGSDFSTHPYTYNEQ
PWNDTELSNFSLTNEDISFKIPMIQNCIKAATSEIHITATTWSPPVWMKTNEKISGYGQL
KTEYYQIYADYHLRFLEEYKKHDIHIWAITTTNEPVNGIIPVVTFNSMGWIPSQLGRWIE
NNLGPTIRKSVFNRTLILGVDDQRLMLSAYMLGMEKAAPNSINYLDGIAVHYYEDFVSPE
ILTNLHKRYPTKIIVATEACEGAYPWETSKVKIGSWDRAQNYVKDIIEDLNNYVVGWIDW
NLCLDPNGGPNWASNFVDSPIIVYEDKGEFVKQPMYYALGHFSKFIPRGSARLQVTTLST
EGIENVAVITPKGNVVVVMQNRKPHTVPVKIYVSSRKAININMEPESIKTVEINSVS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcatacactagtaccaatgacggacttcgtttctctaaaagtcagggtcaagttacg
cacgatgaacaatttgatgcttcggtcgctgaaaaacacgagagtttgcctaaagaattc
gatttcttcacgactggtgttgttttaagagtggacagcaccatcaagtttcaaacaata
gaaggattcggtggagcggtaaccgatgctgcgtctttgaactggaggaagcttccaccg
gccgcacaggataagctaatcgaaacctacttcggtccaaatggcttggaatataatatg
atgcgagtaccaatcggcggatctgacttttcaacccacccttacacttacaatgaacaa
ccctggaacgatactgaactctcgaatttctccctaacgaatgaggatatttctttcaag
ataccaatgattcagaattgtataaaggcagcgactagtgagatacacataaccgctaca
acgtggtcgcctccggtttggatgaaaacaaacgaaaaaatatctggctatggacagctc
aaaaccgaatattaccagatttacgcagattatcatttgcgattcttggaagaatataag
aaacacgacatccatatatgggccatcactacaactaatgaaccagtcaatggtatcata
ccggtggttacgttcaattctatgggatggattccttcgcaattaggtcgttggatagaa
aacaacctcggccctacaataaggaagtctgttttcaatagaacattaattcttggtgtt
gacgaccagaggctgatgctgtctgcttacatgctaggaatggagaaagccgcaccaaac
tccatcaattatttagatggtatagcagtacattattatgaagatttcgtttcacctgaa
attcttacaaatctacacaaacgttatccaacgaaaattatagttgccacagaagcatgt
gaaggtgcgtatccttgggaaacctctaaagttaagatcggatcttgggacagagcacag
aactatgtcaaagacattatagaggatttaaacaactacgtagtgggttggatcgattgg
aacctctgtttggatcccaacggtggcccaaactgggctagcaacttcgtagactcccca
ataattgtatatgaagataaaggagaattcgtgaagcaaccaatgtattatgcattgggg
catttttctaaatttattccaagaggctcagcgcgtctccaagtaacaacgcttagtaca
gaaggcatagagaacgttgcagttataacgccgaaggggaatgttgtggttgttatgcaa
aacaggaagccacatacagtacctgtgaagatatatgtgagcagtagaaaagctataaac
attaatatggaacctgaatcaataaaaactgtagaaattaattctgtctcatga

DBGET integrated database retrieval system