KEGG   Bombyx mori (domestic silkworm): 101742611Help
Entry
101742611         CDS       T02817                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101742611
Peptidases [BR:bmor01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101742611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 393 aa AA seqDB search
MDNFCFQKPYSVSAAPKAKAPKMDSAGDWCLLESDPGVFTQLIHKFGAKGVQVEELWTIE
DSMFENLRPVHGLIFLFKYVNYEEPAGPIVSDDRLDKIFFAKQVINNACATQAVISLLLN
CKHPDLELGPELTKLKEFSMTFDSRMRGLSLSNSQTIRSAHNSMAQQPLFEVDPKMPAKD
EDAYHFIGYMPIDGRLYELDGLQEGPIDHGAVAPEQDWLDVVRPIIMRRINVYTEGEIHF
NLMALVSDRKMIYQRQLDTLLNETQLLARLRMLIDYEEIKMAKYKQELVRRRHNYMPFII
NLLQILAKEKKLMPLLEKAKERATKRKSVYTGNPDLQPEVENLVEMQDVEVPERAQQLLE
SVQDDLMLQPQDSTDSLDVDLKEYNDFEKSDDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataacttttgtttccaaaaaccctacagtgtcagtgcagcacctaaggctaaagct
ccaaagatggattctgccggggattggtgtctcctagagagtgatcctggagttttcact
cagctaattcacaaatttggtgccaaaggtgtacaagttgaggaactgtggactattgaa
gacagcatgtttgaaaatttgagaccagtgcatggtctcattttcctgttcaagtatgtt
aattatgaagaacccgctgggcctattgtatcagatgatcgcttagacaaaatatttttt
gccaaacaggttatcaataatgcctgcgcaactcaagctgtaatcagtctcctgttaaat
tgcaaacacccagatttggaacttggtcctgaattgaccaaactgaaagaattcagcatg
acattcgactcgcgcatgagaggtctctcgttaagcaactcacagactatacgcagcgca
cacaactcaatggctcaacagcctctctttgaagtagatcctaaaatgcctgccaaagat
gaagacgcctatcatttcataggatatatgccaattgatggccgtctttacgaactggat
gggctacaagaaggtccgattgatcatggtgcagttgctccggaacaagattggctcgat
gttgtccgtccaattataatgagaaggattaatgtatacaccgaaggagaaattcacttc
aacttgatggccctcgtatcagatcgtaaaatgatatatcaacgtcagcttgatacactt
cttaatgaaacacagttgctggcgagactgagaatgttgattgattatgaggaaataaag
atggcaaagtacaaacaggagttggtacgcaggcgtcacaattacatgccgttcatcatt
aatttgcttcaaatactggctaaggagaagaagctgatgcccctgctggagaaggccaag
gagcgcgctaccaagcggaaatctgtgtacactggaaatccagacttacaacccgaagtt
gaaaacttagtggaaatgcaggacgttgaggttccagagcgcgcgcagcaattactcgaa
agcgtgcaagatgatttgatgctccaaccgcaagactcgaccgattcccttgacgtagat
ttgaaagagtataatgatttcgaaaaatctgatgatttgtaa

DBGET integrated database retrieval system