KEGG   Bombyx mori (domestic silkworm): 101742640Help
Entry
101742640         CDS       T02817                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bmor00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bmor00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bmor04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 517 aa AA seqDB search
MKILICISLLIFYVSLKGALSDTVCQARGSDAIVCVCNDTYCDTVTREPPIIGAYNTYTT
SESGLRFSKTGGTLNPYNNLTQCGTTLVIEPRVRHQMIEGFGGAVTDAAGIHWKSLSQNL
QNHLIESYFSRNGLEYNMIRVPIGGSDFSTHPYAYNEFPENDATLSNFTLAKEDYQYKIP
LIKSAMSATKRQIHIVATTWSPPPWMKTNNRYSGISRLKPEYFQTYADYHLKFIQKYADE
GIPVWAITTTNEPLSGMLGLDSFNTLGWTQDQMAKWIINNLGPTIRNSTHKNTKILAVDD
QRISIPYWFNYMVAKNPKTLDYIDGIAVHYYTDFITPAYILTEVSKAFPDKFILATEACE
GSFPWQKNKVELGSWTRAANYINDIITDLNHNVVGWIDWNLCLDVNGGPNWAKNFVDSPI
IVFPENGEFVKQPMFYAIGHFSKFIPRGSVRIKVHERKRIFSKSIENVAFLTPYGTIVAV
LYNRGNRASVKIKIRTKEIVLELLAKSISTVEFPYKT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaatttgcatttctttgttaatattctacgtatctttgaaaggagctctt
tctgataccgtatgccaggcgagaggatcggatgcgattgtttgtgtttgtaacgacacg
tattgcgatactgtgacgagggaacctccgattataggcgcatataacacctacaccaca
tccgagagcggcttgcgattcagcaaaactggaggaacattaaacccgtataataattta
acgcaatgtgggacgacattagtaatagaaccaagagtgagacatcaaatgatcgagggc
ttcggtggggccgtcactgacgctgccggtattcactggaagagcttgtcgcaaaacttg
cagaatcatcttatcgagtcatacttcagccgcaacggtcttgagtataacatgatacgc
gttccgatcggtggatcggatttctcaactcatccgtacgcatacaacgaattcccggaa
aacgatgcaacgctaagtaacttcacactagctaaagaagactaccagtataagattcca
ttgataaaatcggcaatgagtgccacaaagagacagatccacatagtcgctacgacctgg
tctccgccaccttggatgaaaaccaacaaccggtattcgggtatcagcaggctcaaacct
gaatatttccagacctacgctgactaccatctgaaatttatacagaagtacgctgatgaa
ggaattccggtttgggcgatcacaaccacgaacgaacccttgtcagggatgcttggcttg
gactcttttaatactctaggatggacacaagatcaaatggcaaaatggataataaataat
ttaggaccgacaattaggaattcgacgcacaaaaatacaaaaatactagctgttgatgat
cagagaatatcaataccttactggtttaactatatggtcgcaaagaacccgaagaccttg
gattatatagacggtatagccgtgcattactacacagatttcatcacccctgcctatata
ttgacagaggtctccaaagcgtttcctgataagtttattttggctaccgaagcatgtgaa
ggaagtttcccgtggcagaagaataaagtggagctcggttcctggacgagggctgcaaac
tatataaacgacattataacagatctaaatcataatgtggtcggctggatagattggaat
ttgtgtttagacgtcaatggcgggccgaattgggccaagaacttcgttgattccccgatc
atagttttccccgaaaatggggagtttgtgaagcagccgatgttctatgcgatcggtcac
ttctcaaagttcataccaagaggttcagtgcggatcaaggttcatgaaagaaaaagaatc
ttctcgaaatcaatagaaaatgtagctttcttaacgccatacggtaccattgttgctgtg
ctttataacagaggcaacagagcttccgtgaaaataaaaatacgaacgaaagagattgta
ttagaattattagcaaaatcgatcagtacagtggaatttccctataaaacatag

DBGET integrated database retrieval system