KEGG   Bombyx mori (domestic silkworm): 101743124Help
Entry
101743124         CDS       T02817                                 

Definition
probable elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101743124
Transfer RNA biogenesis [BR:bmor03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101743124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 555 aa AA seqDB search
MTKKKLLPNLSKEEKMVIVVSEIIQELLVAHRQGKDVNLNKMKTRISSKYGLGTSPRLVD
IIAAVPTDAKKILLPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYNPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMSLPE
DYRDYFIRNLHDALSGHTSTCVAEAVKYSEKAKTKCIGITIETRPDYCQQRHMSDMLNYG
CTRLEIGVQSVYEDIARDTNRGHTVKAVCENFSMAKDAGYKIVAHMMPDLPNVDFERDVE
QFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYRSYPPSTLVDLIAKILALVPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMADLGTDCRDVRTREVGIQEIHNRVRPYE
VELIRRDYVANGGWETFLAYEDPNQDILVGLLRLRKCAGQTYRPELKAKPNSNFVQCSIV
RELHVYGSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSDKMAVISGVGTRNYYAK
IGYHLEGPYMVKMLA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaagaaactattaccgaatctttcaaaagaagagaagatggtaatagtagta
tcggaaataattcaagagttattggtcgctcatcgtcagggcaaagatgttaacctcaac
aagatgaaaacgcggatatcttccaaatacggtctcggcacgtctccgcgactagtggac
atcattgctgctgtaccaacagacgccaaaaagattttgctaccgaaattaaaagctaaa
cctattcgtacagcgtctggtatcgccgttgttgcggttatgtgtaaacctcacagatgc
ccacacataaactttaccgggaacatttgtgtatattgtcccggaggtccggattcggat
tttgaatattcaactcaaagttatactggatacgagcccacatccatgagagcgatccga
gctcgttacaatccttacttgcagactcgtcatagagtggaacagttgaaacaacttggt
catagtgtggacaaggtagagttcattgtgatgggaggaacgtttatgagtttgcctgaa
gactatagagattactttattaggaatcttcacgatgctctgtcaggccacacttcaact
tgtgtagctgaagctgtgaagtactctgagaaagcaaaaacgaaatgcattgggattaca
attgagacaaggcctgattattgtcagcaaagacatatgagtgatatgcttaattatgga
tgcacaaggcttgaaattggtgtacaatcagtttatgaagatatagcccgggacacaaat
aggggacatacagtgaaggcggtatgcgagaactttagtatggctaaagatgctggttac
aagattgtcgcccacatgatgccagatctaccaaacgttgattttgaaagggatgtagaa
caattcattgagttctttgagaaccctgcattccgagctgatggacttaaaatttaccca
acactggtaataagaggtaccggtttatatgaattatggaagaccgggagatacaggagt
tatcccccttcaactttagtcgatctaattgcgaagatattagctctagtgccaccatgg
actagggtgtacagagtgcaaagagacattcccatgcctttggtatcgtcaggagtcgag
catggtaatcttagagagctagctttggcacgaatggcagacttgggtactgattgcaga
gatgtgaggacgagagaggttgggatacaggagatacacaaccgagtcagaccgtatgag
gttgagcttataagacgagactacgtagccaacggtggttgggagacgtttttagcttac
gaagacccgaatcaagatatcttagtaggcttgttgcggctgagaaagtgtgccggtcaa
acttacaggccggaattaaaggccaaacctaattcgaattttgtacagtgcagtattgta
agggagttgcatgtttatggctctgttgtaccagtgaatgcccgagatccaaccaagttt
cagcatcaaggctttggcatgttgctaatggaggaagccgagagaatcgcgcgggaagag
catggttccgacaaaatggccgttatttcgggagtcggaacgaggaattattatgctaaa
attggttaccatctcgaagggccgtacatggtcaagatgcttgcgtaa

DBGET integrated database retrieval system