KEGG   Bombyx mori (domestic silkworm): 101743464Help
Entry
101743464         CDS       T02817                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bmor00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bmor00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 956 aa AA seqDB search
MDIEPAAKEHRDFEMDKPSKFGLKLPLDHEFPLKSKQIIIPRPKQILDMIPLSVRYFKYC
LSKKLRKRRPIMDYFQMISAQRMYGCPIGGIGGGTIGRGFKGEFCRFQLHPGIYEYVTVP
ECQFIVNIRNANNETIFQSVLSTYSKPKKAPASWEWNLDGAKCEYTALYPRAWTTYDLSK
YGVKLVCRQISPVIPHNYKDSSLPCAVFVFTATNTTDERRDVSISFTWTEVLGCSNKKKS
LDKIDLERYSEDYTCGVSLEQRIGESLCTFTIAKKKVDDETIHQGYCLWNAAKTSNYVWE
CIKKDGKLTPDPNLTPPPPKLPDKDAQKKKKDKEKKKLYKCDSVALSSVISLDPGGVSST
EFCLAWDMPVVKYRNDKKIHRRFYTKYFGSDGIAGASIAAYALKHYKNWEKQLLEWQEPI
LTNYNIPDGLKSALMNELYFVADGGTIWFDASDEFPETDPRHEFGLFGYLEGHEYKMYNT
YDVHFYASFALAQLWPNLQVALQYMFRDTIGLESEKSRKSLYDGKVVKFKIKDSVPHDLG
DPDGKPFVNINSYNIHDVSDWKDLNLKFILQVIRDYRVLRAYAAPFTDDKLYRSMPFIDD
VREGTEDDLYSRATGQCDESARPAPAPSPPPPPAATPQDRAPRDVADILELLYRSGEEEV
GAGESVAEPRDPPANVWQDSRYLADMYPACVSLLRRAAAWDRDGDGLIENDGFPDQTYDI
WVMTGPSAYCGGLWVAALGAVRTMAQILGREDDEREFAERLQRAQAAYQEKLWVGSYYRF
DTKPANEKVIMADQLAGHWFLRASGWTEAVFPQANVRKALKTIFDNNVMKFKGGKMGAVN
GFVAEGKGHVHTVALQSEEVWIGVTYGLASLMVYEDMHDEAFVTAGGLYHTLTQMGLSFE
TPEALYENGNHRSIAYMRPLAVWALHQALLARPPPRLPAAAAPPPPHQRAHNNTQL
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgaacccgcagccaaagaacaccgcgattttgaaatggacaaaccatcgaaa
ttcggcttaaaacttcccttagatcatgaatttcccctgaagagcaagcagattataatt
ccaagaccaaaacaaatactggacatgataccgctttcagtcaggtatttcaagtattgt
ttgagcaaaaaactgcgtaaaaggcgtccaataatggattatttccaaatgatttcagca
cagcgaatgtacggatgtcccattggtggaattggaggtggaaccatagggaggggtttt
aaaggggaattttgtcgttttcaactacatcctggtatatatgaatatgtcactgtccca
gaatgccagtttattgtaaacataaggaatgctaacaatgagacaatattccaatcagtt
ctttccacctacagcaaaccaaagaaagccccggcatcttgggaatggaaccttgatggt
gcaaaatgtgaatacacagcactgtatccgagggcatggacaacatatgatctgtcaaaa
tatggtgtgaaacttgtgtgtagacaaatatcaccagtaatacctcataactataaggac
agcagtttgccgtgtgccgtttttgttttcaccgcgactaacaccaccgatgagcgcaga
gacgtgagcatcagtttcacttggaccgaagtactgggatgttcgaataagaagaagtca
ttagataaaatcgatttggaaaggtattctgaggactatacgtgcggagtttcgttagag
caaagaatcggcgaaagcttatgtacgtttacgatagcgaaaaagaaagtcgatgacgaa
acgatccaccagggctattgcctgtggaacgcggcgaagacttccaactacgtttgggaa
tgcataaagaaagatgggaagctaactccggatccaaacttaactccaccgccgcccaaa
cttcccgacaaagacgcacaaaagaaaaagaaagacaaagaaaaaaagaaactgtataaa
tgtgattcagtcgccctgtccagcgtcatatcgttagatccagggggagttagttcaacg
gagttttgtctggcctgggatatgcctgtagttaaatatagaaacgacaaaaaaattcac
agaagattttacacgaaatattttggtagtgacggcatagccggtgcgagcatagctgcc
tacgctctaaagcattacaaaaattgggaaaaacagcttcttgaatggcaggagccaatt
ttaactaattacaatataccagacgggttgaaaagtgccttaatgaacgagctttatttt
gtcgccgatggcggaacgatttggtttgatgcaagcgacgaatttccagaaacggatcct
aggcatgaattcggcttatttggatatttagaaggacatgagtataaaatgtacaataca
tatgacgtccatttttacgcgtcttttgctctagcgcagctgtggccaaatttacaggtg
gcgctgcagtatatgtttcgcgatactataggtcttgaaagtgaaaaaagtagaaagtca
ttatatgacggtaaagtagtgaaattcaagatcaaagattccgtacctcacgacctaggc
gatccagatggaaagccgtttgtgaatataaattcttacaatatccacgatgtcagcgat
tggaaggatctcaatttgaagtttatccttcaagtgatacgggactatagagtcttacgt
gcctacgctgctcccttcaccgatgacaagttgtacaggtccatgccgttcatagacgac
gtgagggagggaaccgaggacgacctgtactctcgcgccacgggacagtgcgacgagtcc
gcgcgtcccgcccccgcgccgtcccccccgccgccccccgccgcgacgccgcaggatcgc
gcgccgcgtgacgtcgccgacatcctcgagctgctgtacagaagcggcgaggaggaggtc
ggcgccggcgagagcgtcgcggagccgcgcgacccccccgccaacgtgtggcaggacagt
cgctacctcgccgacatgtaccccgcctgcgtctcgctgctgcgccgcgccgccgcctgg
gaccgcgacggcgacggactcatcgagaacgacggcttccccgaccagacctacgacata
tgggtgatgacgggacccagcgcgtactgcggcgggctgtgggtggcggcgctgggcgcg
gtgcggaccatggcgcagatcctcggccgcgaggacgacgagcgcgagttcgccgagcgc
ctgcagagggcgcaggccgcgtaccaagagaagctctgggtcggctcctactaccggttc
gacaccaaaccggccaacgaaaaagtgataatggcggatcaattggcgggacactggttc
ctgcgggcgtccggatggaccgaagcggtgttcccgcaagcgaatgtgcgaaaagcactg
aaaacaattttcgacaataacgtgatgaagttcaaagggggcaaaatgggcgccgtgaac
ggatttgtggccgaagggaaggggcacgtgcacaccgtcgcgctgcagagcgaggaggtc
tggatcggagtcacgtacggcctggcctcgctcatggtctacgaagatatgcacgacgaa
gcgttcgtgactgcgggtggtctgtaccacacgctgacgcagatgggtctgtcgttcgag
accccggaggcgctgtacgagaacggcaaccaccgctccatcgcgtacatgcgcccgctg
gcggtctgggcgctgcaccaggcgctgctggcgcgcccgcccccccgcctccccgctgcc
gccgccccgccgccgccgcatcaacgcgcacacaacaacacgcaattataa

DBGET integrated database retrieval system