KEGG   Bombyx mori (domestic silkworm): 101744944Help
Entry
101744944         CDS       T02817                                 

Definition
histone acetyltransferase p300-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101744944
   04330 Notch signaling pathway
    101744944
   04350 TGF-beta signaling pathway
    101744944
   04630 Jak-STAT signaling pathway
    101744944
   04068 FoxO signaling pathway
    101744944
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101744944
Transcription factors [BR:bmor03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101744944
Mitochondrial biogenesis [BR:bmor03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101744944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2012 aa AA seqDB search
MADEPPNKRPKMIRDPFQGPSDSTADGFSNLDMFDLEKDLPDELMGGPWGEQPGVPGPKP
PAQGLGPGQMAPQQQLNGDDPAAAMHRQINNHLLQGNKSGLVGHNNPLGLSSLGSKSPNL
QSPPNVSVSKDLMGGMHQLMPNTSHPNQLHSTMPMSSIQGGMNVTNVGNMIVTNSNMTGA
GMLGSGIINNVNKQLPTLMGNSHHGTHHPHAQNGILQAIQNGPIGGRVGGVGMQAPNIRA
PLQHHPRMQAPGGGGHPLAPYHPTYGQSATGAGAAAGAPLPQRPAGVRFGPSGEMGAGGG
GAAAAVPPAPSPQTPGAPAGGQSQPQAATQSWQCYLPHCKTMKGVLNHMMSCQAGKSCTV
PHCSSSRQIINHWKHCNKNDCPVCLPLKQADRTRSINAAAGGQAPHVTTGVASGVTGGVA
SGVGGGXGACGMASVGIGVGSGGTVQGTIGVAQQLSAPTQEANMKRAYEALGITCPTSVP
NMGGGFPRAPVRMPAPRPPPLTDVVPQQQTQSVQSLFSHQPQPDMQTQQQQQQPQQQTQT
QQQQQQQQLNIILTQMGTGSLQLPGGAVTANPVSGTKEWHQSITADLRNHLVHKLVQAIF
PTPDPSAMLDKRMHNLVAYARKVEGDMYEMACTRSEYYHLLAEKIYKIQKELEEKRQKRK
EQQQLAAQAAQQQAQQQAQSQVQLQQQGVGSAGQVGGGVGVGGAARAALGRGGLAGTAPL
GIRIPSPGIALSMPTARLPFQNNLVGPPGPSPNQMGQTSNGSVGSVGAPGMSPFGSLTSP
APHYAQTNGPAPLASPTHQHIDTNKCVRGGASPFVGVNSPAPGTPATPARASPAPARHLP
PPPPPQPQHHPLVQHEQSPQQQEEIRVKQEPEEPRIKEEPEDDCGGKGMRDEIVSQKDSS
EPDFMVKQEIKQEIKQEAKQEVKQETKLEVKAEIKEEPTESTTDLNNADRGTRKIFVFKP
EDLRQALMPTLEQMFRQDPESLPFRQPVDAQALCIPDYFDIVSKPIDLSTIKSKLDRGVY
KDPWEYVDDVWLMFENAWLYNRKNSRVYRYCTKLSEVFEQEIDPVMQSLGYCCGRKYTFN
PQVLCCYGKQLCTIPRDAKYFSYKNRYTFCQKCFNEIQGDTVTLGDDPLQPQTAIKKDQF
KEMKNDHLEQEPFVMCMDCGRKQHQICVLHHDSIWPQGFCCDNCLKKKGGKRKENKFSAK
KLPTSKLGIYIETRVNNFLKKKEAGAGEVHIRVVASSDKIVEVKPGMKTRFVEPGELSPE
FPYRAKALFAFEEVDGTDICFFGMHVQEYGSESPSPNTRRVYIAYLDSVHFFQPRQCRTA
VYHEILLGYLDYAKQLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQEWYKKMLD
KGIIERIILDYKDILKQAMEDNISSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAE
AAEAVVSMIFQSSEENEQGPDGKKKGQKKAKKSNKSKAAQRKNSKKQSDQQQGSDLSAKI
FATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLNCDLMDGRDAFLTMARDRHYEFSST
RRARYSTLCMLYELHNQGQDKFVYTCNSCKSHVETRYHCTVCDDFDLCVPCYEKEGHPHT
MEKLGLDIDVGSSPGDMKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKMKRVV
THTKICKRKTKGDCPICKQLIALCCYHAKHCTESKCSVPFCSSIKQKLKQQKVQQRVQQA
KLLRRRMAAMNTRAAPPSSPPPHALASPAPSKPAATHVPHNVQKALQQQQRGASPAGPQP
QMHQKALQQLMATLRSPSSHNQQQEILQILKSNPPLMAAFIKQRQNAQNQQAGVGGVGSV
GGVCGVPQQQAPLQHMMQPQQQQRLQQMHQMLPQQPQVGGVSGVGTVGGVSNVGMSAVGA
GGVGTVGGMAHGAAGGWFKQNAAAGVGMMSMRGAYGGVGGVGAVGGAARLGGAGARYSFV
GGGVGGVGGVHKGNVAQDVGTYVVGLTSAPLI
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgagccgcctaacaagcggccgaagatgatcagggacccttttcagggtccc
tctgactccacggctgatggattctcaaaccttgacatgtttgacctcgaaaaggacctc
cctgatgaattaatgggaggtccatggggtgagcagccgggagttccgggccccaagccc
ccggcgcaaggattggggcctgggcaaatggcccctcagcagcagctcaatggagatgat
cctgcagctgctatgcacagacagatcaataatcatcttttacaaggcaacaagagtggc
ttagttggccacaacaatcctttaggattgagtagtttaggcagtaagagtccaaactta
cagtcacctccaaatgtgtctgtatcaaaggacctcatgggtggcatgcaccaattaatg
ccaaatacgagtcacccaaatcaactacattcgacaatgccgatgagttcaattcaaggc
ggcatgaacgtcacaaacgttgggaatatgattgtgacaaatagtaatatgactggagca
gggatgcttggaagtgggataattaacaatgtaaacaagcagctgccgacactgatgggc
aacagccatcatgggacacatcatcctcatgcacagaacggtattttacaggcgatacaa
aacgggcccatcggtggacgagtaggcggggttgggatgcaggcgccgaatattcgcgct
ccattacagcatcacccccgaatgcaagcgccaggtggcggcggtcatccgcttgctcca
tatcatccaacgtacgggcagtctgcaacaggagccggtgccgcggcgggggctccgcta
ccacaaagacccgccggtgtccggttcggtccgtcgggcgagatgggagctggaggaggc
ggggctgccgctgctgtccctcccgctccgtcaccgcagactcccggagctccggcgggg
ggccagtcgcaaccgcaggccgccacccaatcgtggcaatgctacttacctcattgtaaa
acaatgaaaggtgtactaaatcacatgatgtcatgtcaggctggaaaaagttgtactgta
ccgcattgttcgtcgtcgcgacaaattatcaaccattggaaacattgcaacaaaaatgac
tgtcctgtatgtttgcctctgaaacaagcggaccgaactcgcagcataaacgccgcggcg
ggaggacaggctccccacgtgaccaccggagtggcgagtggagtgacgggcggcgtggcc
agcggggtgggtggcggctgaggcgcatgcggcatggccagcgtcggcataggtgtgggc
agcggcggcactgtgcaaggcacgataggcgtcgcgcaacagttgagcgcacctacgcaa
gaggccaatatgaaacgcgcatatgaggcgcttggtataacgtgccccacttctgtgccg
aacatgggcggtggatttcctcgcgcccctgtgcgtatgccggccccgcgccctcctccg
ctcacggacgtggtgccgcagcaacagacgcagtccgtacagtcgctgttctcgcaccaa
ccgcagccggacatgcagacgcaacaacagcaacaacaaccccagcaacaaacccagacg
cagcagcaacaacagcaacaacaactgaatattattttaactcagatggggacgggatcc
ctccagctcccgggtggagccgtgaccgccaatccagtatcgggaacgaaggagtggcac
caatcgatcacggctgatctcagaaaccacctagtccacaaactggttcaagcgatattc
ccgacaccagacccatcggcgatgctcgataaacggatgcacaacttagtagcttatgct
agaaaggttgagggtgacatgtatgaaatggcatgtacgcgatcagaatattatcacttg
ctagctgagaaaatctataaaattcagaaagagctagaagaaaaaagacaaaaaagaaaa
gagcaacaacagttggccgcccaggctgcacagcaacaagcgcagcagcaggcccagtca
caggtgcagcttcagcaacaaggtgttggaagtgcaggccaggtaggcggaggtgttggc
gtgggcggcgctgccagggcggcactgggccgtggtgggctggccgggactgcacctctc
ggcatccgcattccttcgcccggcatcgcactctccatgcccacggcaagactgcccttc
cagaacaaccttgtgggaccgcccggacctagtcccaaccagatgggtcaaacgtcgaat
ggaagtgtgggtagtgtgggtgcgccgggcatgtcgccgttcgggtcgttgacctccccc
gccccccactacgcgcagaccaacggacccgcgccgcttgcctcccccacgcaccaacac
atcgacaccaacaagtgcgtgcgtggcggtgcgagtccgttcgtgggagtgaactcgccc
gcgcccggcacccccgccacccccgcgcgcgcctcccccgcgcccgcccgccacctgccg
ccgccgccgcccccgcagccgcagcaccacccgctcgtgcaacacgaacagagtccccaa
caacaagaagaaattcgtgtcaaacaagaaccagaggagcctcggattaaagaagaaccc
gaggatgactgtggcggaaaaggaatgcgggatgagattgtttctcaaaaagattcaagc
gaaccggacttcatggttaaacaagagatcaagcaagaaattaaacaagaagctaaacaa
gaagtcaaacaagaaactaagctggaagtcaaagcggagatcaaagaagaacccacggag
agcactactgacttgaataatgccgaccgagggacgaggaagatctttgtgttcaaaccc
gaggacctgcggcaggcgctcatgcccacactcgaacaaatgttccgacaagaccccgag
tccctgcccttccgccagcccgtcgacgcgcaggccctgtgcatcccggactacttcgat
atcgtcagtaaaccgatcgacttgtccaccatcaagtcgaagctggaccgcggcgtctac
aaggacccctgggagtatgtcgacgacgtgtggctgatgttcgagaacgcctggctctac
aatagaaaaaattctagagtttacagatattgtactaagctatcagaagtattcgagcag
gagattgatcccgtgatgcagagtttgggctattgttgtggacgaaaatacacattcaac
ccccaagtgttatgctgttacggcaaacaactgtgtaccatcccgagagacgccaagtac
ttcagctacaagaacagatacacgttctgccagaaatgcttcaatgagatccagggcgac
accgtgacgctcggcgacgacccgctacaaccgcagactgctattaaaaaggatcagttt
aaagaaatgaaaaatgaccatttggaacaagaaccgtttgttatgtgcatggactgtggc
aggaaacagcaccagatctgtgtattacaccatgattcgatatggccccaaggcttctgc
tgtgataattgtttgaagaagaaggggggcaaacggaaagagaacaagtttagtgcgaag
aaactgcccacctctaaacttggcatttatattgaaactagagtcaataatttcctaaag
aagaaagaggctggtgccggtgaagtgcatatcagggttgtcgcctcttctgataagata
gtagaagtgaaaccaggaatgaaaacaagattcgtagagcctggtgaattatctcccgaa
ttcccgtacagggccaaagctttatttgcatttgaagaagttgatgggactgatatttgt
ttctttggtatgcatgtgcaggaatacggcagtgagagtccgtcacccaatacgaggcgc
gtttatatagcatatctagactcggtacatttctttcaaccgcgtcagtgcaggacggca
gtgtaccatgagattttattaggatatttagattatgctaagcaactgggttataccatg
gcacacatatgggcgtgtccgccgtcggagggagatgactatattttccactgtcatccg
cctgaacaaaaaattccaaagcccaaaaggttgcaagagtggtataagaaaatgttagat
aaaggaattatagagaggataatattagactataaagacattctcaaacaagcaatggag
gacaacatctcttcagcggctgagctgccgtattttgagggcgacttctggccgaatgta
ctagaagagtccataaaagaattagatcaggaggaagaggagaaaagaaagcaggcagaa
gccgccgaggcagtggtcagtatgatattccagtcgtcagaggagaacgagcagggccct
gatggtaagaagaaaggccagaagaaggcgaagaaatcaaacaagtcaaaggcggcccag
agaaagaacagcaagaaacaaagtgatcagcaacagggaagtgatctcagtgcaaaaata
tttgcaaccatggagaaacacaaggaagtgttcttcgttataaggctacattccgcacag
tctgctgctagtttagctcctattcaagaccctgatccattattaaattgtgacctcatg
gacggtcgtgacgcgttcttaaccatggcgcgagatcgacattacgagttttcgtcgaca
agaagggcgaggtactcgacgctgtgcatgctgtacgagctgcacaaccagggccaggac
aagttcgtgtacacgtgcaacagctgtaagtcgcacgtcgagaccaggtaccactgcacc
gtctgcgacgacttcgacctgtgcgtgccctgctacgagaaggagggacatccgcacacc
atggagaagctcggcctcgacatcgacgtgggctcctcgccgggagacatgaagcaagcc
aacccgcaggaggcgcgcaagcagtccatccagcgctgcatccagtctctggtgcacgcg
tgccagtgccgcgacgccaactgcaggctgccgtcctgccagaagatgaagcgggtcgtc
acccacaccaagatctgcaagcgaaagacgaagggcgactgtccgatctgcaagcaactg
atagcgctgtgctgctaccacgccaagcactgcacggagtcgaagtgctcggtgccgttc
tgcagcagcatcaagcagaagctgaagcagcagaaggtgcagcagcgcgtgcagcaggcc
aagctgctgcggcggcgcatggcggccatgaacacgcgcgccgccccgccctcctccccg
ccgccgcacgcgctcgcctcgccggccccctccaagcccgccgccacgcacgtgccgcac
aacgtgcagaaggcgctgcagcagcaacagcgaggcgcgagtccggccggtccgcagccg
cagatgcaccagaaggcactccaacagctgatggccacgctgcgctcgcccagcagtcac
aaccaacaacaggagatattgcaaatactcaaatccaatccgccgctgatggccgccttc
ataaaacaacgacagaacgcgcaaaatcaacaagcgggtgtaggaggcgtgggctcagtg
ggcggggtgtgcggcgttcctcagcaacaagcgccgttgcagcacatgatgcagccgcag
cagcagcagcgactgcagcagatgcaccagatgttgccgcagcagccgcaggtgggtggt
gtgtcaggagtgggcacagtgggcggcgtgtccaacgtaggcatgagtgcagtcggcgcc
ggcggcgtggggaccgtaggcggcatggctcacggtgctgccggcggttggtttaagcaa
aacgcggcggccggcgtgggcatgatgagcatgcgtggtgcatacggcggagtgggcggc
gtgggtgcggtgggcggagcggcgcggctgggcggtgcgggcgcgcgctacagtttcgtg
ggcggcggcgtgggtggtgtgggcggcgtgcacaaaggaaacgtagctcaggatgtagga
acgtacgtagtcggtctgacgagcgcccctctgatttag

DBGET integrated database retrieval system