KEGG   Bombyx mori (domestic silkworm): 101744994Help
Entry
101744994         CDS       T02817                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101744994
   00514 Other types of O-glycan biosynthesis
    101744994
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     101744994
Glycosyltransferases [BR:bmor01003]
 Terminal extension
  Sialyltransferase
   101744994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MCALKRIKVNTVTKRDEPFARYDFQIPEGPLQDGTFYNTCAVVSSAGALLGSRLGDFIDS
HDMVLRFNNAPTDNYTDDVGSKTTFRILNSQVVSKPEYKFLEDPLYKGVSIIIWDPANYS
STLEEWYNHPDFPLFPVYKKFLEETPNADAHLLNPQVLWSLWAVLQNVSPYRLRRNPPSS
GFIGLWFSLNRCRRVRVFEYVPSTRASRRCHYYAHRDDVACTFGAWHPLAQEKALAETLR
DNSDIDTFQRGFIDITGLATIQC
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgttaaagcgcataaaagtgaatacggtgaccaagagagatgaaccttttgca
cgctacgattttcaaattcctgagggtccccttcaagacggtacattttataatacttgc
gctgtcgtcagcagtgcaggagctctgcttggatcaagattgggtgatttcatagattca
catgatatggtgttaagatttaacaatgctccgactgataattatacagacgacgtcgga
tcaaagacaacattccgtatcttaaattctcaggttgtatcgaaacctgaatataaattt
ctagaagatccattatataaaggcgtttccataataatctgggatccggcgaactattcg
tctacgctagaagagtggtataatcatcctgatttcccgttgtttcctgtttataagaaa
tttcttgaggagacgccaaatgcggatgcgcatttattaaatccgcaggtattatggtcc
ctatgggcggtccttcaaaacgtatcgccttatcgcttacgaagaaatccaccatcttca
ggttttattggtttgtggttttccctgaatcgttgtcgcagagttcgcgttttcgaatat
gtaccgtcaacacgtgcgagtcgccggtgtcattactatgcacatcgcgatgacgtcgcg
tgtacattcggggcctggcatcctttggcgcaagagaaggctttggctgaaaccctaagg
gataattcggatatcgacacctttcaacgaggtttcattgacattaccggactagctaca
atacaatgttga

DBGET integrated database retrieval system