KEGG   Bombyx mori (domestic silkworm): 101744994Help
Entry
101744994         CDS       T02817                                 

Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 2
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 285 aa AA seqDB search
MHNTYDVKYKSGPKNALSKHDVMCALKRIKVNTVTKRDEPFARYDFQIPEGPLQDGTFYN
TCAVVSSAGALLGSRLGDFIDSHDMVLRFNNAPTDNYTDDVGSKTTFRILNSQVVSKPEY
KFLEDPLYKGVSIIIWDPANYSSTLEEWYNHPDFPLFPVYKKFLEETPNADAHLLNPQVL
WSLWAVLQNVSPYRLRRNPPSSGFIGLWFSLNRCRRVRVFEYVPSTRASRRCHYYAHRDD
VACTFGAWHPLAQEKALAETLRDNSDIDTFQRGFIDITGLATIQC
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatacttacgatgtaaaatacaaaagtggccccaagaatgcgttatcaaaacac
gacgtgatgtgtgcgttaaagcgcataaaagtgaatacggtgaccaagagagatgaacct
tttgcacgctacgattttcaaattcctgagggtccccttcaagacggtacattttataat
acttgcgctgtcgtcagcagtgcaggagctctgcttggatcaagattgggtgatttcata
gattcacatgatatggtgttaagatttaacaatgctccgactgataattatacagacgac
gtcggatcaaagacaacattccgtatcttaaattctcaggttgtatcgaaacctgaatat
aaatttctagaagatccattatataaaggcgtttccataataatctgggatccggcgaac
tattcgtctacgctagaagagtggtataatcatcctgatttcccgttgtttcctgtttat
aagaaatttcttgaggagacgccaaatgcggatgcgcatttattaaatccgcaggtatta
tggtccctatgggcggtccttcaaaacgtatcgccttatcgcttacgaagaaatccacca
tcttcaggttttattggtttgtggttttccctgaatcgttgtcgcagagttcgcgttttc
gaatatgtaccgtcaacacgtgcgagtcgccggtgtcattactatgcacatcgcgatgac
gtcgcgtgtacattcggggcctggcatcctttggcgcaagagaaggctttggctgaaacc
ctaagggataattcggatatcgacacctttcaacgaggtttcattgacattaccggacta
gctacaatacaatgttga

DBGET integrated database retrieval system