KEGG   Bombyx mori (domestic silkworm): 101745091Help
Entry
101745091         CDS       T02817                                 

Definition
(RefSeq) ribokinase-like
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101745091
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101745091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin PGA_cap ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 101745091
NCBI-ProteinID: XP_004928242
Position
Un
AA seq 314 aa AA seqDB search
MDTKNGYKLVVLGSCSVDFTTYAPKLPKSGETLHGTKFTTSFGGKGANQCVAAAKLGGNA
YMICRVGDDQWGKKYKDHLKNEGVNVSYVHITKNETTGVAQIVVAENGENQIVIVPGANK
CLSVQDVEESIELIKNADVLIGQLETPFETTYTAFKLNNGIKLLNAAPALTDIRKILPFC
TILCVNELEASVLTNVDVTISNASMAAKKLLETGCETVIITLGSEGAVYMSKNEECPKHV
LCEAVNPVDTTGAGDAFIGALATFLVEYKDYPLHQLIGAACAVATISVTVEGTQTSYPTK
NDFFCKKYEYVQLE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggataccaaaaatggttataaacttgtagttcttggctcttgtagtgtggattttaca
acatatgcaccgaaactgcctaaatctggagaaactttacatggtacaaaattcactacc
agtttcggaggaaaaggtgcaaaccagtgtgttgctgctgcgaaattaggtggaaatgcc
tacatgatttgtagagtgggggatgatcagtggggtaaaaaatataaagaccatctcaaa
aatgaaggtgttaatgtgtcttatgttcacatcacaaagaatgaaacaacaggcgtagca
caaattgttgtagcagaaaacggagaaaatcaaatcgttattgtaccgggagctaataaa
tgtctaagtgtccaagatgtagaagagtcaattgaattgataaaaaatgctgatgttcta
ataggacagcttgaaactccgtttgaaactacttatacagcatttaagttaaataatggt
ataaaactattaaatgccgctccagcgttgactgatattcggaaaattttgccattttgt
actatactttgtgttaatgaattagaagcatcagttctcactaatgtggatgtcaccatt
tcgaatgcttcaatggctgcaaaaaaattgctggaaactggctgcgaaacagttataata
acactaggatctgaaggagctgtttatatgtcaaaaaacgaagaatgtcctaaacatgtt
ttatgtgaagctgttaatcctgtagataccacaggtgccggcgatgctttcattggagct
ttggcaacatttctggtcgagtataaagattatccactgcaccaattaatcggcgcagct
tgtgcggtcgcaaccatttcagttacagtggaaggcacacaaacgagttatcctacgaaa
aatgatttcttttgtaaaaagtatgagtacgtccaactggaataa

DBGET integrated database retrieval system