KEGG   Bombyx mori (domestic silkworm): 101745097Help
Entry
101745097         CDS       T02817                                 

Definition
NAD-dependent protein deacetylase Sirt6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101745097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 370 aa AA seqDB search
MSCNYAEGLSPYENKGILGVPEKFDSNDKLNQKCVLLAQLVKDSKHIVVHTGAGISTSAG
IPDFRGPNGVWTLEKEGKKPTINVSFADAQPTKTHMILKKLVEIKKLKYIVSQNIDGLHL
KSGVPRKFLAELHGNMFIDECNICKRQFVRSSPVETVGKKCSGVPCAAHHVTGRPCRGRL
YDGVLDWEHSLPENDLLMAEWHSSIADLSICLGTTLQIVPSGNLPLETIKYGGKLVICNL
QPTKHDNKADLLINYYVDDVLEKVMDILGIEIPSYNESENPMKFAETAIIDWSIDRKDVL
ALEKTFKSKCKGVKKKRILIKTKRFTSNANDIEKSKMIKLEVKEENETKDWPLKPSDQEF
IIDQKGSIVS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcaattatgcagaaggactatcaccttatgaaaacaaaggtatactaggagtc
ccagagaaatttgattcaaatgacaaactgaaccagaaatgtgtactcttggctcaactt
gtgaaagatagtaaacatattgttgtccacactggagctggcataagtacttctgcgggt
attccagactttagagggccaaatggagtgtggactttagagaaggaaggtaaaaagcca
accatcaatgtatcatttgctgatgcacaacccacaaaaacccatatgattttaaaaaag
ttggttgaaataaaaaaacttaaatacattgtgagtcaaaacattgacggacttcatctc
aagtctggtgtcccaagaaaattcttagctgaactacatggaaatatgtttattgatgaa
tgtaacatctgcaagagacagtttgtccgtagcagtcctgtcgaaactgtaggcaagaaa
tgcagtggtgtgccttgtgcagctcaccatgtgacgggtagaccttgccgtggtagatta
tatgacggagtgcttgactgggagcatagcttgcctgaaaatgatttgctaatggcagaa
tggcattcaagtattgcagacttgagcatatgtctaggtacaacacttcaaatagtacca
agtggtaatttaccactagagactattaaatatggtggaaagttagttatttgcaaccta
caaccaacaaaacatgacaataaagctgatctcctaataaattattatgtagatgatgta
cttgagaaagtaatggacatcttaggaattgaaatccccagttataatgaatctgagaac
cccatgaaatttgcagaaacagctattattgactggtcaatagacagaaaagatgtctta
gctttagaaaagacattcaaatcaaaatgcaaaggagttaaaaagaaacgaatattaata
aaaacaaaaagatttaccagtaatgccaatgatattgaaaaatcaaaaatgatcaaatta
gaagttaaggaagagaatgaaactaaagactggccattgaaaccttcggatcaagaattt
ataattgatcaaaagggttctattgtgtcttga

DBGET integrated database retrieval system