KEGG   Bombyx mori (domestic silkworm): 101746108Help
Entry
101746108         CDS       T02817                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmor00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 311 aa AA seqDB search
MFQTINSKIVLPIIFGVGSVVVLATIIANCLWGKKSKGSSKKLITLVDSNVKYALPLIER
EEISHDTRRFRLGLPSPQHVLGLPIGQHIHLSAKINDDLVIRAYTPVSSDEDKGYVDLVI
KVYFKNVHPKFPEGGKLSQYLNNMKINDTIDVRGPSGRLQYTGNGTFLIKKLRKDPPTKV
VVKKLNLIAGGTGIAPMLQLVRHICTDVNDRTELKLLFANQSEDDILLRDELERYQREHP
SQFQVWYTIDRPTDGWKYSSGFINDEMIRDHLFPPSNDVLVLMCGPPPMINFACNPALDK
LGFKPDQRFAY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagactatcaattctaaaattgtactaccaataatatttggtgttggatcagtg
gtagtcttagcaactataatagccaattgtctatggggaaagaaatctaaaggatctagc
aaaaagttaataacattagtagattctaacgtaaaatatgcattaccgctgatagaaagg
gaagaaatcagtcatgacaccaggagattcaggctgggactgccgtctcctcaacatgta
ttgggattaccgatcggtcaacatattcatttgtctgcaaaaattaacgacgacctagtc
ataagagcatacacgccggtgtcgagcgatgaggataaaggctatgtcgatttggttatc
aaggtatactttaagaatgtacatccgaagtttcccgagggagggaagctgtctcagtac
ttgaacaatatgaagataaatgatactatagatgtccgtggaccgtcagggagattgcag
tacacaggaaacggaacattcctcattaagaaattaagaaaagatccgcctacaaaagtt
gtcgtcaagaaattgaacttgattgcaggcggtactggcatagctccaatgcttcagctg
gtccgacatatatgcactgacgtcaacgaccgcaccgaactgaagctgctattcgcgaac
caaagcgaagatgacattctacttagagatgaattagaaagataccaaagggaacatcct
tcccaattccaagtttggtacacgattgatcggccaacggatggttggaaatacagctcc
ggtttcatcaacgatgaaatgatccgcgaccatttgtttccgccgtccaacgatgttcta
gtactgatgtgcggtccaccgccgatgatcaacttcgcttgcaacccagctttagataaa
ttaggctttaagccagaccaacgctttgcttattaa

DBGET integrated database retrieval system