KEGG   Bombyx mori (domestic silkworm): 101746165Help
Entry
101746165         CDS       T02817                                 

Definition
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
Orthology
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101746165
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101746165
  Energy metabolism
   00190 Oxidative phosphorylation
    101746165
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101746165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 282 aa AA seqDB search
MPLLRLTTGTFGQLRTFATSASLAKRVKTFAVYRWNPDEPDKKPYTQNFEVDLDDCAPMV
LDALLKIKNEVDPTLTFRRSCREGVCGSCAMNIDGVNTLACISHIDQNISKPTKIYPLPH
MYVVKDLVPDLTNFYRQYQSIEPWLQRENEAVKGKETQLLQDVEDRVKLDGLYECVLCAC
CSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDEATEKRLSKLKDTYSVYRCHTIMNCTR
TCPKGLNPGRAIAQIKTLLSGIVKKQPPIMDPAGLQKQTASN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgcttaggctgacgactggtaccttcgggcagctgcgtacgtttgctacgtca
gcatccctcgcaaaacgtgttaagaccttcgcagtctatcgatggaaccccgatgagccc
gacaagaaaccttatacgcaaaatttcgaagtggatttggacgactgcgcacctatggta
ttggacgctttgctgaagattaagaacgaagtagacccaaccctgaccttcagacgttcg
tgccgagagggcgtttgtggttcttgtgcgatgaatatcgacggcgtcaacactctggcc
tgcatcagccatatcgatcaaaacatttccaagccgacgaagatttatcctctacctcac
atgtacgtcgtcaaagacttggtccccgatctgaccaacttttaccggcagtaccagtct
atcgagccgtggctgcagcgtgaaaatgaagctgttaaaggtaaggagactcaattgctc
caggacgtagaggaccgcgtcaagttggatggtctctatgaatgtgtgctatgtgcttgc
tgttcgacgagttgcccgtcctactggtggaatggagataagtacctaggccctgctgtc
ctcatgcaggcctacaggtggatcattgactcccgagatgaagccactgagaaacgttta
tcaaaactcaaggacacatactcggtataccgttgccatacaatcatgaactgcactcgc
acatgccctaaaggtctgaacccaggccgggccattgcccagatcaaaaccttactctcg
ggtatagttaagaagcagccacctataatggaccctgctggcttgcagaagcagacagcg
agcaattaa

DBGET integrated database retrieval system