KEGG   Bombyx mori (domestic silkworm): 101746165Help
Entry
101746165         CDS       T02817                                 

Definition
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
Orthology
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101746165
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101746165
  Energy metabolism
   00190 Oxidative phosphorylation
    101746165
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101746165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 282 aa AA seqDB search
MPLLRLTTGTFGQLRTFATSASLAKRVKTFAVYRWNPDEPDKKPYTQNFEVDLDDCAPMV
LDALLKIKNEVDPTLTFRRSCREGVCGSCAMNIDGVNTLACISHIDQNISKPTKIYPLPH
MYVVKDLVPDLTNFYRQYQSIEPWLQRENEAVKGKETQLLQDVEDRVKLDGLYECVLCAC
CSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDEATEKRLSKLKDTYSVYRCHTIMNCTR
TCPKGLNPGRAIAQIKTLLSGIVKKQPPIMDPAGLQKQTASN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgcttaggctgacgactggtaccttcgggcagctgcgtacgtttgctacgtca
gcatccctcgcaaaacgtgttaagaccttcgcagtctatcgatggaaccccgatgagccc
gacaagaaaccttatacgcaaaatttcgaagtggatttggacgactgcgcacctatggta
ttggacgctttgctgaagattaagaacgaagtagacccaaccctgaccttcagacgttcg
tgccgagagggcgtttgtggttcttgtgcgatgaatatcgacggcgtcaacactctggcc
tgcatcagccatatcgatcaaaacatttccaagccgacgaagatttatcctctacctcac
atgtacgtcgtcaaagacttggtccccgatctgaccaacttttaccggcagtaccagtct
atcgagccgtggctgcagcgtgaaaatgaagctgttaaaggtaaggagactcaattgctc
caggacgtagaggaccgcgtcaagttggatggtctctatgaatgtgtgctatgtgcttgc
tgttcgacgagttgcccgtcctactggtggaatggagataagtacctaggccctgctgtc
ctcatgcaggcctacaggtggatcattgactcccgagatgaagccactgagaaacgttta
tcaaaactcaaggacacatactcggtataccgttgccatacaatcatgaactgcactcgc
acatgccctaaaggtctgaacccaggccgggccattgcccagatcaaaaccttactctcg
ggtatagttaagaagcagccacctataatggaccctgctggcttgcagaagcagacagcg
agcaattaa

DBGET integrated database retrieval system