KEGG   Bombyx mori (domestic silkworm): 101746328Help
Entry
101746328         CDS       T02817                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101746328
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101746328
Glycosyltransferases [BR:bmor01003]
 Glycan extension
  Type 3 chain
   101746328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 362 aa AA seqDB search
MREYLITERMYPQKCTMTEGRVMGRRFVLTLVIGISAGFSFAYILLTSTAGSRDVAWPAY
RESLRDLDRHPIVNIVDHGSDEPAHKDEDRSIADELSKRVRVLCWVMTQPSNHEKKAKHV
KATWGKRCNKLLFMSSVEDSNLPSVKLPVQEGRDYLWAKTKAAFRYVYEHHRREADWFLK
ADDDTYVVVENLRYMLADYSSNDPVYFGCRFKPFTPQGYMSGGAGYVLSREALDQFVNKA
LPSPHLCKASDHGAEDAEIGKCLHNIGVRAMDSRDSMRRGRFFPFVPQDHLFPNKDKGFW
YWSYIYYPSDEGLDCCSDHAVTFHYVNPQQMYVFDYLIYHLRPYGITFGAGELPKILRND
TK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtatttaattactgagcgaatgtacccacagaaatgcacaatgactgaaggt
cgggtgatgggtcgtcgatttgtgctaaccctggtgatcggcatatcggccggatttagt
tttgcgtacatattattaacatccacggcaggctcaagggatgtggcttggccagcgtac
agagagtccctacgtgacctcgacagacatccaatagtgaatatagttgatcacggaagc
gacgaaccggcccacaaggatgaggaccgatcgattgccgacgaactgtccaaacgcgtc
agagtgttgtgctgggtgatgacgcagccgagcaaccatgagaaaaaggccaaacacgtg
aaggccacgtgggggaaacggtgcaataaactactcttcatgagcagcgttgaagacagc
aacctgccatcggtaaagcttcccgtgcaagaaggtcgagattacttgtgggcgaagacg
aaagccgccttcagatacgtgtacgaacatcaccggagggaggccgactggttcctgaaa
gccgacgacgatacttatgttgtcgtcgaaaatctgaggtacatgttggctgactacagt
agcaacgatcctgtgtacttcggatgcaggttcaagccgtttacgccccaggggtacatg
agcggcggcgcgggctacgtgctcagccgggaggcgctggaccagttcgtgaacaaggcg
ctgccctccccgcatctgtgcaaggccagcgaccacggcgcagaggacgcggagatcggc
aaatgtctccacaacatcggggtgagggcgatggactcccgcgactcgatgaggcggggc
cggttcttcccgttcgtcccgcaggaccacctgttccccaacaaggacaagggcttctgg
tactggagctacatctactaccccagcgacgagggcctggattgttgctccgaccacgcc
gtgacgttccactacgtcaacccgcaacagatgtacgtgttcgactatctcatataccac
cttcggccttacggcatcacgttcggagctggcgagctgcccaagatactcaggaacgat
accaagtag

DBGET integrated database retrieval system