KEGG   Bombyx mori (domestic silkworm): 101746890Help
Entry
101746890         CDS       T02817                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101746890
   01210 2-Oxocarboxylic acid metabolism
    101746890
   01230 Biosynthesis of amino acids
    101746890
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101746890
Enzymes [BR:bmor01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101746890
Amino acid related enzymes [BR:bmor01007]
 Aminotransferase (transaminase)
  Class I
   101746890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MSQLKLISRVSRVLSGAVKRSELFEINKVNTNNARTMASKGLTVENMNPNIVKLEYAVRG
PLVIRAGEIEKELEKGAQKPFKRVIKANIGDAHAMGQKPITFIRQVMACLALPDLIEKGI
FPEDVKQRAREILDACGGGSVGSYTASHGIELVRRRVADYIQRRDGHPAHWEDIFLSSGA
STANKNCLQLFCNDLGGKTSGVMIPIPQYPLYSASLAEYGLAQVGYYLDEEHHWGLDLRE
LERSLAEASATCNVRALVVINPGNPTGQVLTRDNIESIIKFAKKHGLFLFADEVYQDNVY
AAGSKFHSFKKVLVELGDDYKDVELASFMSVSKGYMGECGARGGWAELRGVNAAVRAQLY
KCISAMLCPNVLGQAAIDCVARPPQPGEPSYELYIKEKTDVLDSLKKRAEMIVDAFNQMQ
GFKCNVVQGAMYAFPRFELPPRAVAAAAAAGIPPDTFYAFRLLEETGICIVPGSGFGQRP
GTYHFRTTILPQPELLREMLDIFKKFHQKFTAEYSG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagttaaagttgataagccgcgttagtcgcgttttatccggtgcggtgaaacgt
tcagagttattcgaaattaacaaagtaaacacgaacaacgcaagaacgatggcatccaaa
ggcttgactgtggaaaacatgaatcccaacattgtcaagttggaatacgctgtgcgcggg
ccccttgtcattcgcgctggcgagattgaaaaagaacttgagaagggcgcacagaaacct
ttcaagcgagtgatcaaggcgaatatcggagatgcccatgccatgggacagaagcctatc
actttcatcagacaggtaatggcgtgcctggccctccccgacctcatcgagaagggaatc
tttccagaggatgtgaaacagagagcccgagagattttggatgcttgtgggggcggctcc
gtgggctcgtacacggcgtcgcacggcatcgaactggtgcggcgccgcgtggccgactac
attcagcgccgggacggacaccccgcgcactgggaggacatcttcctctcctccggggcc
tccaccgccaacaagaactgcctgcagctgttctgcaacgatctgggaggaaaaacttca
ggagtcatgatccccatcccgcagtacccgctgtactcggcctcgctggcggagtacggc
ctggcgcaggtcggctactacctcgacgaggagcaccactgggggctggacctccgcgag
ctggagaggtccctcgccgaggccagcgccacttgcaacgtcagggccctggtcgtcatc
aaccccgggaacccgacaggacaggtgctgacccgagacaacatcgagtcgatcataaag
ttcgcgaagaagcacggtctgttcttgttcgcggacgaggtgtaccaggacaacgtgtac
gccgccgggagcaagttccactcgtttaagaaggtgctggtggagcttggcgacgactac
aaggacgtggagctggcgtcgttcatgtcggtcagcaaggggtacatgggcgagtgcggc
gcgcgcggcggctgggcggagctacgcggcgtgaacgcggccgtgcgggcgcagctctac
aagtgcatcagcgccatgctgtgccccaacgtgctgggacaggccgccatcgactgcgtg
gcgcggcccccgcagcccggcgagccctcctacgagctgtacatcaaggagaagacggac
gtgctggactcgctgaagaaacgcgccgagatgatagtggacgccttcaaccagatgcag
ggcttcaagtgtaacgtcgtgcagggcgcaatgtatgccttcccgcgcttcgagctgccc
ccccgcgccgtggccgccgccgccgccgccggcatcccccccgacaccttctacgccttc
aggctgctcgaggaaaccggtatctgcatagtgccgggcagcgggttcgggcagcggccg
ggtacctaccacttcaggaccaccatcctgccgcagccggaactgctgcgagagatgctg
gacatcttcaagaagttccaccagaagttcacagccgagtactcgggctag

DBGET integrated database retrieval system