KEGG   Bombyx mori (domestic silkworm): 101747022Help
Entry
101747022         CDS       T02817                                 

Definition
membrane-bound alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101747022
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101747022
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101747022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 558 aa AA seqDB search
MARQWIAVLAFAVVLVLTDAEDAATTPKPKKVLETVMNPAYIPAEEKHGSYWKKSAASTL
KSKLKEKTNKNKARNGILFIGDGMSLATVMAARTYAGQLDRGLGEENILEFEKFPVTGLA
RTYCLDAQVPDSACTATSYLTGVKTKYGVIGLDGNVTRGSCHSQLHKGNWAPSIGQWAIE
NGLDVGLVTTTRVTHASPAGMYAHVSERNWESDVDVPAECLTLGCRDIAYQLVMDNPGRQ
FKVILGGGRREFLPNVTGFGNNTGKRVDGVDLTELWHVDKLQKNVSHQYVTDRLELLKVY
NSDDLPEYLLGLFNTDHMAYHLKAEDEPTLEEMVEVAIKMLSRNPKGYFLFVEGGRIDHA
HHDSLAYLALDETVEYAKAVRKARSLTDESETLIVVSSDHAHTMTVAGYPSRGNDILGVV
DTTNGGDGRPYTTISYANGKAASIDTDGLRVDVTKEKGFTERSLDYAYPSLVPLDSETHG
GEDVAVFALGPWQHLFTASYDQSVVPHLMAYAMCLTDDQHQNCHQPERLTEAASSAVSVY
PYQLLLAQAVISIISCLL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgacaatggatcgcagtgctggctttcgccgttgtcctcgtcctgactgacgca
gaagatgcagcgaccacgccgaaacccaagaaggttctggaaaccgtcatgaatccagcc
tacataccggctgaagaaaaacacggttcctattggaagaagtctgctgcatcaacacta
aaatctaaactaaaagagaagaccaacaaaaataaggccagaaacggaattctttttatt
ggcgatggaatgtcgttggccactgtcatggcagcccggacttatgccggccaactggat
cgagggctgggagaagagaatattctcgaattcgagaaattcccggtgaccggattggct
aggacatactgcttagacgcccaagtgccggattcagcgtgcaccgccacctcatacctg
accggagtgaagactaaatacggagtaataggcttagatgggaacgtgacccgaggatca
tgtcactcccaactccacaaaggaaactgggcgccgtctattggacaatgggccattgaa
aacggattagacgttggtttggttacaacaactagagtgacgcacgcctcacccgccggc
atgtatgctcacgtttccgagagaaattgggagtcggacgttgatgtaccagcggagtgc
ctgacccttggctgccgggatatcgcgtaccagctcgtcatggacaacccagggagacag
ttcaaggtcatcttgggcggcggcagacgagaattcctcccgaacgtcactggctttggt
aacaacaccgggaaacgggttgatggagtggatctaaccgagctgtggcacgtggataag
ctccagaagaatgtgagccatcagtacgtgacagacagactggagctcttgaaggtatac
aattctgatgatttacccgaatacctcctgggattgttcaacactgaccacatggcgtac
catttgaaggcagaagacgagccgactttggaagagatggtggaagtggccatcaaaatg
ctcagcaggaacccgaagggatatttcctgttcgttgaaggtggaagaatagaccacgcg
catcacgacagcctcgcgtatttggcgttagacgagaccgtcgaatacgctaaagccgta
agaaaagccagatcgctgaccgacgaatctgagacccttattgtcgtgagctccgaccac
gcccacaccatgaccgtggccggctacccgtccagaggcaacgacatcctgggcgtggtg
gacacgacgaacggtggcgacggaagaccttacactacgatcagctacgcaaatggaaaa
gccgcttccattgacacggacgggctcagagtcgacgttacgaaggaaaaaggatttacg
gagcgtagcttggattacgcgtacccaagtctcgtgcctctggactcggagacccacggc
ggcgaggacgtggcggtgttcgcgctgggaccctggcagcacctgttcaccgccagctac
gatcagtccgtggtgcctcacttaatggcgtacgcgatgtgcctcacggacgaccagcat
cagaactgccaccagcccgagaggctcacggaagccgcctcgagcgcggtgtcagtctat
ccataccaactattattagcccaagctgtgatatcaattattagttgtctcttatag

  All links  
No link information was found.   
DBGET integrated database retrieval system