KEGG   Bombyx mori (domestic silkworm): 101747054Help
Entry
101747054         CDS       T02817                                 

Definition
(RefSeq) cytosolic 10-formyltetrahydrofolate dehydrogenase
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101747054
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101747054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 926 aa AA seqDB search
MPPVSLTDHAPKKSLRVAIIGQSTFAAEVFKLIQRDGHEVVGVFTIPDKGNREDPLATIA
AQNGKPVYKYKSWRIKGQVIPEVLEQYKSVNADLNVLPFCTQFIPMEVITAPKYESICYH
PSILPRHRGASSVNWTLIEGDTTCGFSIFWADDGLDTGPILLQKSYPTTIDDTVDTIYNK
FLYPEGIKALAEAVNMVANGVAPKIKQSEEGATYDPALFKPETHLIDWSKGGLALHNFVR
GLDSSPGATSFIEPQTKEGIIGDGEKIEIKFFGSSLWQSEYETEGDKLYITGLNKPAVVH
EAGLLVTANDGVRLNIQRLKVNGKMINAQNFFKASEEKISIELNSDELKFVESCRELWRA
ILRIEIENHTDFFASGAGSMDVVRLVEEVKDLANVELQNEDVYMNTTFEEFYSVAVLKAR
GGSDTKEVVYEGLEMEVNKMKIKFPTQLFINGEFVNADSGKTLTLINPTDESVICKVQSA
SPNDVDKAVRAAKKAFDEGEWSKISARERAQILFKLADLMEQHKEELATIESIDSGAVYT
LALKTHVGMSIDTWRYFAGWCDKIQGATVPINHARPNRNLCITRKEPIGVCAIITPWNYP
LMMLSWKMAACLAAGNTVVMKPAAVCPLTALKFAELCVRAGVPPGVVNILPGSGAACGQA
LADHPLVRKLGFTGSTPIGQTIMKSCAASNMKKVSLELGGKSPLVIFEDCDLDKAVRNGM
AAVFFNKGENCIAAGRLFVEETIHDEFVRRVIEETEKIRIGDPLHRGTSHGPQNHKAHMD
KLIEYCERGVKEGAKLVYGGKRVDRKGYFFQPTVFTDVTDEMYIAKEESFGPIMIISKFS
SKNLEDVIRRANNTEYGLASGVFTRDVSRALQFAERIDAGTVFVNTYNKTDVAAPFGGFK
QSGFGKDLGQDALNEYLKTKCVTIEY
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagtatcattgactgatcatgcaccaaaaaaaagcctaagagttgccattatt
ggccaaagtacatttgcagctgaagttttcaaactcatccaaagagacggtcatgaagtt
gtgggtgtcttcacaattcctgacaaaggcaacagggaggaccctttagctactattgcc
gcacagaatggaaaaccagtttacaaatacaagtcttggcgtattaaaggacaagtcatc
cctgaagtacttgagcagtacaaatccgtgaacgccgacctcaatgttctaccgttctgc
actcaattcatacccatggaggtgatcacggctcctaaatacgagagcatctgttaccat
ccgagcattttacccagacatcggggagcttcatcagttaattggaccttgatcgagggt
gacactacatgcggcttctccatattttgggcggacgacggcttagacaccggccccata
ttactgcaaaagagctatcccacaaccatcgatgacaccgtagacacgatctacaacaaa
ttcttatatcctgaaggtatcaaagccttagctgaagccgtcaacatggttgcgaatggt
gtggctcctaaaatcaagcagtctgaagaaggcgccacatacgacccagctcttttcaaa
cctgaaactcatctgatcgattggagcaaaggagggctggctctgcacaacttcgtgcga
ggactggactcatcaccgggagccacctccttcatcgaacctcagaccaaagaggggata
atcggagacggtgaaaaaattgagataaaattcttcggatcctccctctggcaatctgaa
tatgagaccgaaggagataaactgtatataacaggccttaataaaccagccgtggtccac
gaagccggcttacttgttactgccaatgatggagttaggctcaacatacagaggctaaaa
gttaacgggaagatgatcaacgctcaaaacttcttcaaagctagcgaagagaagatctct
atagaactgaattcggatgagttaaagttcgtggagagctgccgcgagttgtggagggcg
attcttcgcattgaaatcgaaaaccacaccgacttcttcgcatccggagccggctctatg
gacgtcgtgaggctggtcgaagaagtcaaggacttggcgaacgtggagctccagaatgag
gatgtatacatgaacaccacgtttgaagagttctatagtgtggccgtgttgaaggcgaga
ggcggctcggatacaaaagaggttgtttatgagggactcgaaatggaggtcaataaaatg
aagattaaattcccgacacagctgtttattaatggcgagttcgtgaacgctgacagtggt
aaaaccttgaccctgatcaatccaacggacgagagcgtgatctgtaaagtgcaaagcgcc
tcgcccaacgacgttgacaaggcagtgcgggccgctaagaaggcgttcgatgaaggggaa
tggtccaagatcagtgcccgtgagagagcacaaatcttatttaagttggcagatttgatg
gaacaacacaaagaggagctggccacaatcgaatccatagactcgggagctgtctacacg
ttagcactcaaaacccacgtgggcatgtccatagacacgtggcgctacttcgctggctgg
tgcgacaagatccaaggcgccaccgtgcccataaaccacgccaggccaaacagaaatctg
tgcatcacgagaaaagagccgatcggcgtttgcgcgataataacgccctggaattatccg
ctgatgatgctgtcgtggaagatggcggcctgtctcgctgctggcaatactgtcgtcatg
aaacccgctgcggtgtgccccctgacagcgttgaagttcgccgagctgtgcgtccgagcg
ggggttccccccggcgtcgtgaacatcctccccgggagcggcgcggcgtgcgggcaggcg
ctcgccgaccatccgctcgtccggaagctgggcttcacaggcagcactcccatcggtcaa
accataatgaagtcgtgtgcagcatcgaatatgaagaaggtgtcgttggagctaggaggc
aagtcgcctctcgttatattcgaagactgcgatctggacaaagccgtcagaaacggtatg
gcagctgtgttcttcaataaaggcgagaattgcatagcagcaggtcggttgttcgttgaa
gagacgatacacgacgagttcgtacgtcgcgttatagaggagaccgagaagatccgtatc
ggcgacccactgcaccggggcacttcacacggaccccagaaccataaggcgcatatggat
aaactgatagagtactgcgagcgtggcgtcaaagaaggtgccaagctagtgtacggaggc
aagagggtggatagaaaaggctatttcttccagccgactgtctttaccgacgtcacagac
gagatgtacatcgccaaggaggaatcgtttggacccatcatgatcatcagcaagttcagc
agcaagaatttggaggacgtgatccgtcgcgcgaacaacacggagtatgggctcgcgagc
ggcgtgttcacgcgggacgtgtcgcgggcgctgcagttcgccgagcgcatcgacgcgggc
acggtgttcgtcaacacgtacaacaagaccgacgtggcggcgcccttcggaggcttcaag
cagtccggcttcggaaaggacttgggccaagacgctctcaacgaatatctgaaaacgaaa
tgcgtgacaatagaatattaa

DBGET integrated database retrieval system