KEGG   Bombyx mori (domestic silkworm): 101747223Help
Entry
101747223         CDS       T02817                                 

Definition
protein O-mannosyltransferase 1-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101747223
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     101747223
Glycosyltransferases [BR:bmor01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101747223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 777 aa AA seqDB search
MDTGRCVKNRKINKIRKEVTEPQEYSYSEKTCNSHREVGDGAPAENETEKPELMLTNKMN
HSPSRIYLQLKIDVIAIGLLILALCTRLYKLDEPRHIVFDELHYGRYVSLYTKGVFFFDA
HPPLGKQLLYLAGSIAGYDGNFTFDRIGTPYTDNVPVKALRLVPAVSGSFLVLITYFLML
ELSLHQWTAILAALLVLLENCFLAQSRFMLLESIQILFGLCGVYCIIKSTKRIGLTALVW
LCAAAVLLGCCFSVKYSGLYTYYLSLFLVGRHIWLQLDQIKSGTRLLFSALWRFAVLLII
PLAVYVSVFYMHLSMLPKAGPHDSVMTSAFQASLQGGLASITHGQPLHVAHGSQITLRHT
HGRTCWLHSHAHVYPVRYADGRGSSHQQQVTCYSFKDVNNWWIVKRPDQASLAVSRPPDA
IRHGDIVQLLHGITSRALNSHDVAAAVSPQSQEVSCYIDYNVSMPAQNLWRVDIVNRDSE
ESTWDSIRSLVRLVHVDTGSGLRYSGRQLPAWGFHQHEIVADKVLSHQDTIWNVEEHRYT
KADDRKERERELVTAEMIPTAVTQLTFWEKFTELQYKMIAHAPDAPHGHMFASEPAEWPL
LVRSIAYWLSPDSNAQIHLIGNIVTWYTGTISVVVYSALLAIYSVRKRRACEDLPPFVLN
KFYETGYTLFLGYWLHYLPYFFIDRTLFLHHYLPAYIFKILLLAYIMDHIYLVLQLHEKT
KHVTNLFILCVTIWLSYIVLTFKKFSVLNYGNVDLKENDLMSLRWKDTWDFILHKKI
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggacacaggacggtgtgttaaaaatcgtaaaataaacaagattcgtaaggaggtcaca
gaacctcaggagtacagttattcggagaaaacatgtaattcccatcgagaagtgggcgat
ggtgccccagctgaaaatgaaactgaaaaaccagaattaatgctgacgaacaaaatgaat
cattctccttcacgcatatatttacagctcaagattgatgtaatcgcaataggacttcta
atattggcattatgcactcgtttatataaactagatgaacctcgccatattgtatttgat
gaattacattatggaagatatgtttcattatatactaagggtgtctttttttttgatgct
catccaccacttggcaaacagttgttatatctagctggtagtattgctggatatgatgga
aactttacttttgaccggattggtactccatatactgacaatgttcctgtgaaggctctc
aggctagttccagctgtgtcaggaagttttctagttttaattacatattttttgatgcta
gaactatctttacatcaatggactgccatacttgctgctttattagtgctccttgaaaat
tgtttcttagcacagtcaaggttcatgttgctggaaagcattcagatactatttggcttg
tgcggtgtgtattgtattattaaaagtacaaagagaattggactcacagcacttgtttgg
ctatgtgctgctgctgttttgcttggttgttgcttctcggtgaaatactctgggctgtac
acatactatttatcattattcttagttggaagacacatatggttgcaactagaccaaata
aaatcaggaacacgtttattattttctgccttgtggcggtttgcggtcttattgatcatc
ccgctggctgtgtatgtgagcgtgttttacatgcatttgtctatgttgccaaaggctgga
ccgcatgacagtgttatgacgagtgcattccaagcctcattacagggcggccttgcgagc
ataacgcacggacagccattgcatgtcgctcacggctctcaaataacactcaggcacacc
cacggcaggacctgttggctccattcacacgcacacgtatatccagtgcgttatgcggac
ggacgtggctcctcacaccagcagcaagtgacttgttacagcttcaaagatgtcaacaat
tggtggattgtaaaacggccggaccaagcgtcgctggccgtttcgcgacctccagacgct
ataagacacggagatatcgtacaactgttgcatggaataacgagtcgcgctttgaattcc
cacgatgtggccgcagctgtttcgcctcaatctcaagaagtgtcttgctacatcgactac
aatgtatcgatgccagctcagaatctttggcgtgtggatattgtgaatcgtgattctgaa
gagtcaacctgggatagcatacgctcgttagtgagacttgttcacgttgacacggggtcg
ggcttgcgttacagtggtcgccaacttccggcttggggtttccatcaacatgagattgtt
gctgacaaggtgttatcccatcaagatacaatatggaatgttgaagagcatcgctatacc
aaagccgatgatcgaaaagaacgggaacgcgagttagtcacggctgaaatgataccgact
gcagtgacccaattaactttttgggaaaaatttacagaattacaatataaaatgatagca
cacgcacctgatgcccctcacgggcacatgtttgccagcgaaccagctgaatggcctctg
cttgttcgttcaattgcatattggctctctcctgactctaatgctcaaatacatctgata
ggcaacattgtaacatggtatactgggacaatatcggtagtagtctacagtgccctcctg
gctatttactccgttcgaaaacgtcgagcttgtgaagacttgcctccatttgttttgaat
aagttttatgaaactggctatacattatttctaggttattggttacattacctaccttac
ttttttatagatcgaactctgttccttcatcattatttacctgcatatatttttaagatt
cttcttttggcttatattatggatcatatttacttagttttacagctccatgagaaaact
aaacatgttacaaatttatttatattatgtgtaacaatatggctgtcatatatcgtgctt
acatttaaaaaattcagtgttctgaactatggaaatgttgatttaaaggaaaatgatcta
atgagtcttaggtggaaagatacctgggactttatattacataaaaagatataa

DBGET integrated database retrieval system