KEGG   Bombyx mori (domestic silkworm): 692567Help
Entry
692567            CDS       T02817                                 

Gene name
Desat1, ACD, Bmpgdesat1, Desat2
Definition
(RefSeq) acyl-CoA delta-11 desaturase/conjugase
  KO
K21709  
(11Z)-hexadec-11-enoyl-CoA conjugase [EC:1.14.19.15]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.15  (11Z)-hexadec-11-enoyl-CoA conjugase
     692567 (Desat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MPPNSVDKTNETEYLKDNHVDYEKLIAPQASPIKHKIVVMNVIRFSYLHIAGLYGLYLCF
TSAKLATSVFAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTW
VRDHRLHHKYTDTDADPHNATRGFFFSHIGWLLVRKHPMVKIAGKSLDMSDIYCNPLLRF
QKKYAIPFIGTICFIIPTLAPMYFWGESLNNAWHITVLRYIFSLNGTFLVNSAAHLWGYK
PYDKSLKATQSGMANAFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWA
YDLKTASTNIIEKRALRTGDGTYKRPNGMN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaattcagtggataaaacaaatgaaacagaatacctcaaggataatcatgtt
gattatgaaaaactcattgcaccccaggcctcgcccatcaaacacaaaattgtagtgatg
aacgtgatacgttttagctatttacatattgctggtctatatggactttatctctgtttc
acctcagcaaaattggctacatcggtttttgctattgtgttattcttccttgggaacttt
ggtattacagctggagctcatcgtctgtggtctcataatggttacaaagtcaaactgccc
ctcgagatcctgttgatggtcttcaacagtattgcttttcagaacaccattttcacatgg
gtgagagatcacaggctacatcacaagtatacggacactgatgcagaccctcataatgct
acgagaggtttttttttctcacacatcggctggttgttggtgcgaaaacatccaatggtg
aaaattgctggaaagagccttgacatgtcagatatttattgtaatcctcttttaagattt
cagaaaaagtacgcaataccatttataggaacaatatgttttatcataccgacattagct
ccaatgtatttttggggtgaaagcttaaacaacgcttggcatattacagttttaagatac
attttcagtctcaatggcacttttcttgtaaatagcgctgctcatttgtggggatacaaa
ccgtacgataagagcctgaaagctactcaaagtggcatggcaaatgcatttacttttggt
gaaggatttcacaattaccatcacgtttttccgtgggattatcgggcagacgaattgggg
gacaggtacataaatttgacaacaaggttcatagatttctttgcatggatgggatgggct
tatgatctgaaaactgcttccaccaatattattgagaagagggcactaagaacaggggat
gggacttacaaacgaccaaatggaatgaattga

DBGET integrated database retrieval system