KEGG   Bombyx mori (domestic silkworm): 692568Help
Entry
692568            CDS       T02817                                 

Gene name
Desat3
Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bmor01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bmor01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 353 aa AA seqDB search
MPPQRKQEASWVLYEADANNLPEDAPPHVPPSAEKRPWKIVWRNVILFFILHVGGVYGGY
LFLFKAMWRTSIFAIFLYLCSGLGITAGAHRLWAHKSYKARLPLRILLTIFNTIAFQDAV
VDWARDHRMHHKYSETDADPHNATRGFFFSHIGWLLLRKHPEIKAKGHTVDVNELRNDPI
LRFQKKYYQILMPLACFIMPTYVPTLWGETVWNSFYVCAIFRYVYVLNITWLVNSAAHMW
GSKPYDKNINPVETRPVSLVVLGEGFHNYHHTFPWDYKTAELGDYSLNLSKLFIDFMAKI
DWAYDLKTVSTDVIQKRTKRTGDGSHPVWGYDVGEVATEDKTDTTNLVNSKVL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcctccccaaaggaaacaggaggcttcgtgggtattgtacgaagccgacgccaataac
ctgccagaagatgcaccgccccatgtacctccctcagcagagaagagaccttggaagatt
gtgtggagaaatgtgattctgttctttattctgcatgtcggtggtgtttatggagggtac
ttgttccttttcaaagccatgtggaggacttctatattcgccatatttttgtacttgtgt
tcgggattgggtatcacagctggcgcgcacagactttgggcacacaagtcctataaagct
cggctgccactgagaatattactcaccatattcaatactatcgcttttcaggatgccgta
gtggattgggcccgtgatcatcgcatgcaccacaaatattcagagaccgatgcggacccc
cacaacgcaacccgaggattcttcttttcccacattggctggttgttgttgaggaagcat
cccgaaatcaaagccaaaggccataccgtcgacgtgaatgagctgcgcaatgatcctatc
ctacgttttcagaagaagtactaccaaattttaatgcctttagcctgtttcatcatgcct
acatatgtaccaacattgtggggagaaacagtttggaactccttctacgtctgcgcaatt
ttccgctacgtatatgttctcaatataacttggttggtcaactcagcagcacatatgtgg
ggtagcaaaccttacgataagaacatcaaccccgtcgaaaccaggcccgtctcgttagtg
gtgctcggcgaaggattccacaactaccatcacacgttcccgtgggattacaaaaccgcc
gaacttggagattattcccttaatttgagcaagctgttcattgatttcatggcgaagatc
gattgggcttatgaccttaagacagtatcaactgacgtcattcagaaacgaacgaaaagg
acaggtgatggaagccatcccgtatggggatacgatgttggggaggtcgctactgaagac
aaaactgatactactaatcttgtcaattctaaagtgctctga

DBGET integrated database retrieval system