KEGG   Bombyx mori (domestic silkworm): 692783Help
Entry
692783            CDS       T02817                                 

Gene name
ace1, Bmace1, ace2
Definition
acetylcholinesterase type 1 (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    692783 (ace1)
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     692783 (ace1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 683 aa AA seqDB search
MRVVLAALTALAARTLAGPHEHRARHHAPAPPQPYHGHGEAVRYNPELDTILPRLEDHET
SSKRASDAETSSKRTKYEERFYSNHERAAELMADEPVSEKGDEEDPLVIRTRKGKVRGIT
LTSATGKKVDAWFGIPYAQKPMGDLRFRHPRPVEDWGDEILNTTTLPHSCVQIVDTVFGD
FPGAMMWNPNTDMQEDCLYINIVTPRPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVS
EEKVVYVSMQYRVASLGFLFFDTADVPGNAGLFDQLMALQWVKDNIGYFGGNPHNITLFG
ESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIISREESILRGIRLAEAVHCPHSR
SDLAPMIECLRKKNADELVNNEWGTLGICEFPFVPIIDGSFLDEMPVRSLAHQNFKKTNI
LMGSNTEEGYYFILYYLTELFPKEENVGISREQFLQAVRELNPYVNDVARQAIIYEYTDW
LNPEDPVKNRNALDKMVGDYHFTCGVNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGV
MHADEINYVFGEPLNPGKNYSPEEVEFSKRLMRYWANFARSGNPSLNPNGEMTKIHWPVH
TAFGREYLSLAVNSSSVGRGLRVKQCAFWQKHLPQLMAATNKPEPPKNCTNSVPSLWPSR
NTLGFNVIATAALTGTALFKYTI
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggtgttggcagcgctgacggcgctggcggcgcgcacccttgccggtccgcac
gagcaccgggcgaggcaccacgcgcctgcgcctccgcagccctaccacggccacggcgag
gccgtccgatacaaccccgaactcgataccatcctaccaagactcgaagaccacgaaact
tcgtctaagcgcgccagtgatgcggaaacttcgtccaagagaaccaagtatgaggagaga
ttttactctaatcacgaacgagccgcggagctcatggccgatgagccggtctcagaaaaa
ggagacgaagaggaccctctagttattcgcactaggaaggggaaggtgagaggaattacg
ctgacttcagcaactggaaagaaggtcgatgcgtggttcggaatcccttatgcacaaaaa
cctatgggcgatttgaggttcaggcacccaagaccagtcgaagattggggcgatgaaatt
cttaacacaacaacactgccacattcctgcgtccaaatagttgacacggtattcggtgac
tttcccggagctatgatgtggaatcccaatacagatatgcaggaagattgtctttatatt
aacatagtgacacctcgaccacgtccaaagaatgctgcggttatgctatgggtatttggg
ggaggcttttattccggtacagccactttagatgtttatgacccaaaaatacttgtttcg
gaagaaaaagttgtgtatgtgtccatgcagtacagagttgcatcacttggatttttgttt
ttcgatacggcagacgtccctgggaatgctgggctatttgatcagctgatggcattgcaa
tgggtgaaagataatattggctatttcggagggaatccacataacataacattatttggt
gaatcagcaggagctgtgtctgtgtcgttacatttgctatctcccttgtcgaggaacctg
ttctctcaagctatcatgcagtctggagccgccactgctccatgggctataatttcgaga
gaagaaagtattctgcgtggcataagattagctgaagctgtccactgtccacattcaaga
tcggatttggctcctatgatagaatgcttgcgaaaaaagaatgcggatgaattggttaat
aatgagtgggggacattgggtatatgtgaatttccgtttgttcctatcattgatggatcg
tttctggacgaaatgccagtaaggtcgttagctcatcaaaacttcaagaaaacaaatatt
cttatgggatccaataccgaagaaggatattattttatactctattacctaactgaattg
tttccaaaagaggagaacgttggaattagccgggaacagtttcttcaagcagtgagagaa
ctcaatccgtatgttaatgacgtagcaaggcaggctatcatatacgagtacactgattgg
ttgaatcctgaagatccggtaaagaatcgcaacgctctcgacaaaatggtcggagactat
catttcacttgtggagtaaacgaatttgcccatcgttatgcagaaactggtaataatgtt
tacacttattattacaagcatcgtagtaagaataacccttggccgtcctggactggtgtg
atgcatgctgacgagataaactatgtgttcggggagcctctcaatcccgggaaaaattat
tcgccggaagaagtcgaattcagcaaacgcttaatgagatattgggcaaacttcgctagg
tctggaaatccgtctctgaatccaaacggcgaaatgacgaagatacattggccggttcac
acggcctttggacgggaatatttatcactggctgtgaactccagttcagttggtcgtggt
ctacgcgttaaacagtgcgctttttggcagaaacatctcccccagttaatggctgctacc
aataaaccagagccgccgaagaattgtacgaattctgttccttctttgtggccatctcgc
aatactctcggcttcaacgtcatagcaaccgctgcgcttacaggcacagcactgttcaaa
tacaccatataa

DBGET integrated database retrieval system