KEGG   Bombyx mori (domestic silkworm): 692924Help
Entry
692924            CDS       T02817                                 

Gene name
AK, BmAK
Definition
(RefSeq) arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00330  Arginine and proline metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    692924 (AK)
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     692924 (AK)
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   692924 (AK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 692924
NCBI-ProteinID: NP_001037402
UniProt: Q2F5T5
Position
Un
AA seq 355 aa AA seqDB search
MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL
DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV
STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL
IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ
VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgccgcaaccctcgagaaattggaggctggtttcagcaagctccagggatcc
gactctaagtcgctgctgaagaagtaccttaccagggaagtattcgacagcctgaagaac
aaaaagacctcattcggatccaccctccttgactgcatccaatcgggtgtcgagaacttg
gactccggcgtcggtatctacgcgccggacgccgagtcgtactccgtgttcgccgagctg
tttgacccgatcatcgaggactaccacaatggcttcaagaagaccgacaagcacccgccc
aagaactggggagacgtggacacgctcggcaacctcgaccccgccggcgagttcgtggtc
tccacccgcgtgcgctgcggccgctcgctcgaggggtaccccttcaacccctgcctcacc
gagtcccagtacaaggagatggaggacaaggtctccggcaccctgtccagcctcgagggc
gagctcaagggcacgttctaccccctcaccggcatgtcgaaggagacccagcagcagctc
atcgacgaccacttcctgttcaaggagggcgaccgcttcctgcaggccgccaacgcctgc
cgcttctggcccaccggccgcggcatctaccacaacgagaacaagacgttcctcgtgtgg
tgcaacgaggaggaccacctccgcatcatctcgatgcagatgggtggcgacctgcagcag
gtatacaagaggctggtgagcgccgtcaacgagatcgagaagaagatcccgttctcgcac
cacgaccggctcggcttcctcacgttctgcccgaccaacctgggcaccacggtccgcgcc
tccgtgcacatcaagctgccgaagctggcggccgacaagaagaagctggaggaggtggcg
tccaagtaccacctgcaggtccgcggcacgcgcggcgagcacacggaggccgagggcggc
gtgtacgacatctccaacaagcgccgcatggggctcaccgagtacgacgccgtcaaggag
atgtacgacggcatcgccgagctcatcaagatcgagaagtctctgtag

DBGET integrated database retrieval system