KEGG   Bombyx mori (domestic silkworm): 692924Help
Entry
692924            CDS       T02817                                 

Gene name
AK, BmAK
Definition
arginine kinase (EC:2.7.3.3)
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    692924 (AK)
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     692924 (AK)
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   692924 (AK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 355 aa AA seqDB search
MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL
DSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVV
STRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQL
IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQ
VYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgccgcaaccctcgagaaattggaggctggtttcagcaagctccagggatcc
gactctaagtcgctgctgaagaagtaccttaccagggaagtattcgacagcctgaagaac
aaaaagacctcattcggatccaccctccttgactgcatccaatcgggtgtcgagaacttg
gactccggcgtcggtatctacgcgccggacgccgagtcgtactccgtgttcgccgagctg
tttgacccgatcatcgaggactaccacaatggcttcaagaagaccgacaagcacccgccc
aagaactggggagacgtggacacgctcggcaacctcgaccccgccggcgagttcgtggtc
tccacccgcgtgcgctgcggccgctcgctcgaggggtaccccttcaacccctgcctcacc
gagtcccagtacaaggagatggaggacaaggtctccggcaccctgtccagcctcgagggc
gagctcaagggcacgttctaccccctcaccggcatgtcgaaggagacccagcagcagctc
atcgacgaccacttcctgttcaaggagggcgaccgcttcctgcaggccgccaacgcctgc
cgcttctggcccaccggccgcggcatctaccacaacgagaacaagacgttcctcgtgtgg
tgcaacgaggaggaccacctccgcatcatctcgatgcagatgggtggcgacctgcagcag
gtatacaagaggctggtgagcgccgtcaacgagatcgagaagaagatcccgttctcgcac
cacgaccggctcggcttcctcacgttctgcccgaccaacctgggcaccacggtccgcgcc
tccgtgcacatcaagctgccgaagctggcggccgacaagaagaagctggaggaggtggcg
tccaagtaccacctgcaggtccgcggcacgcgcggcgagcacacggaggccgagggcggc
gtgtacgacatctccaacaagcgccgcatggggctcaccgagtacgacgccgtcaaggag
atgtacgacggcatcgccgagctcatcaagatcgagaagtctctgtag

DBGET integrated database retrieval system