KEGG   Bombyx mori (domestic silkworm): 693015Help
Entry
693015            CDS       T02817                                 

Gene name
Lzm, BmLys
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     693015 (Lzm)
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   693015 (Lzm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
Un
AA seq 137 aa AA seqDB search
MQKLIIFALVVLCVGSEAKTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNT
NRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAW
YGWKNHCQGSLPDISSC
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagttaattattttcgctttggttgtcctctgcgttggttctgaagccaaaacg
ttcacgagatgcggtctcgtgcatgagctgaggaagcatggcttcgaagaaaatctcatg
aggaactgggtatgtctggtcgagcacgagagcagccgtgacacgtccaagacgaacacg
aaccgtaacggctcgaaggactacggattgttccagatcaacgaccggtactggtgcagc
aaaggcgccagtccgggcaaagactgcaacgttaagtgctccgacctcctgactgacgac
attactaaggcagcgaaatgcgctaagaaaatttacaaacgtcaccgcttcgatgcctgg
tacggttggaagaaccactgccagggctctctgcctgatattagcagctgctaa

DBGET integrated database retrieval system