KEGG   Bacillus velezensis: NG74_01061Help
Entry
NG74_01061        CDS       T03423                                 

Gene name
yhfS
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase YhfS
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmp  Bacillus velezensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NG74_01061 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    NG74_01061 (yhfS)
   00640 Propanoate metabolism
    NG74_01061 (yhfS)
   00650 Butanoate metabolism
    NG74_01061 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    NG74_01061 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    NG74_01061 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NG74_01061 (yhfS)
   00310 Lysine degradation
    NG74_01061 (yhfS)
   00380 Tryptophan metabolism
    NG74_01061 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NG74_01061 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NG74_01061 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NG74_01061 (yhfS)
Enzymes [BR:bmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NG74_01061 (yhfS)
Exosome [BR:bmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NG74_01061 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1026461..1027552)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSMYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKANEDGLYRREILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
RLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacgattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgattcgccatttgagccgaaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccggacttcctttgagcgtgtccggtacgaccatcgacaga
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttgttaaagccggcgcg
gggagcatgtacatcgcgggaggagcggagagcagcagccgttcccctttctcttcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgaacgaagacggcttataccgccgggaaattcttccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aaacccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggtgcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagcca
agattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagcc
ccggtttatgccgtcaaaaagcttttgaaggaacggaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system