KEGG   Bacillus megaterium QM B1551: BMQ_0099Help
Entry
BMQ_0099          CDS       T01208                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87521..88066
Genome map
AA seq 181 aa AA seqDB search
MTTEAYIALGSNIENRMEHLKSGVTGLMKHSEVKVVAVSSVYETAPVGYTNQASFLNMVV
KIQTTYSSEQLLDCLQAIEQAAGRKREIVWGPRTLDLDILLYSNEIIHTDRLSVPHPRMF
ERAFVMVPLNELAPSLILPVAEEKVETITTRLSDLKDVKLFREQTTGIIDMFENNSNDLH
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaagcatatattgcattaggatcaaatattgaaaatcgaatggaacatttg
aagtcaggagttactggcttgatgaaacactctgaggttaaggtagtggctgtttcatct
gtttatgaaacggccccggtcgggtatacgaatcaagcaagctttttaaacatggtagta
aaaatacaaacaacgtattcgtcagagcaacttttagattgtttgcaagccattgaacaa
gcggcaggtcgaaaaagagagattgtatgggggcctagaacccttgatttagatatctta
ctttatagtaatgaaatcattcatacggatagattgagcgtccctcatccccgaatgttt
gaacgggcgtttgtgatggttcctctaaacgagctagctccatctcttattctccctgta
gcagaagaaaaagttgaaaccatcacaacacgtttatcggatttaaaagatgtaaaatta
tttcgagagcaaacaactggtataatagatatgttcgaaaataatagtaatgatttacat
aagtaa

DBGET integrated database retrieval system