KEGG   Bacillus megaterium QM B1551: BMQ_0415Help
Entry
BMQ_0415          CDS       T01208                                 

Definition
putative thioredoxin peroxidase (EC:1.11.1.-)
Orthology
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
bmq  Bacillus megaterium QM B1551
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389344..389814
Genome map
AA seq 156 aa AA seqDB search
MTAVVGEKAPDFVLMSTNGEQVSLASMKGKNVVLYFYPKDMTPGCTTEACDFRDQHENFE
ELDAVILGVSPDPIDKHHKFIDKHGLPFLLLADEDHSVAEEYGVWTLKKNFGKEYMGIER
STFIINKEGMLVKEYRKVRVKGHVEEALSFIKEKMA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgtagttggagaaaaagcacccgattttgtattgatgtctacaaatggagag
caagtatcactagcgtcgatgaaaggcaaaaacgttgtgctgtatttttatccgaaagat
atgacgccaggctgtacaacagaagcctgtgatttcagagatcagcatgaaaattttgaa
gagctagatgcggtgattctaggagtgagtccggatccaatcgacaaacaccataagttt
attgataagcacggccttccattcttacttttagctgacgaagatcacagcgtagctgaa
gagtatggagtatggacactgaaaaaaaactttggaaaagaatatatgggcattgaacgc
tccacttttatcattaataaagaaggaatgctcgtaaaagaatatcgcaaggttcgagtg
aaagggcatgtggaagaagctttatcatttattaaagaaaaaatggcataa

DBGET integrated database retrieval system