KEGG   Bacillus megaterium QM B1551: BMQ_0457Help
Entry
BMQ_0457          CDS       T01208                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BMQ_0457
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMQ_0457
   00600 Sphingolipid metabolism
    BMQ_0457
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BMQ_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420553..422778
Genome map
AA seq 741 aa AA seqDB search
MGVLFNERTKEFHLQGRDVSYIFSVLRNGQLGHLYYGKKLKHRSSFQHFLRVETRGASAS
VYEGELAFSLETIKQEYPSYGTTDFREPAYQLLQQNGSRITNFEYDNHKIYKGKKPLNGL
PATYVEEESEATSVEVELIDKLLNASLILTYTVYEDRNIITRHARFEHRGEEAVDILRIM
SGSIDLPTSNYEMVQLSGAWIRERHVKTRMLQPGIQSISSARGTSSSQQNPFLILKNPDA
TEHSGEAYGFSLVYSGNFLGQVEVDHYNVSRITMGIHPFDFQWRLESGQTFQSPELVLAY
SNSGLNGLSQEYHELYRKRLARGKWRDLERPVLINNWEATYFDFNEEKIVHIAKEAQKLG
VELFVLDDGWFGKRNDDTTSLGDWFVDENKLPGGMKSLAQKVTDLGMDFGLWFEPEMISK
QSNLYEKHPDWLIHVPNRYQSHGRNQYVLDFSREEVVNYIYERMEAILSEAPISYIKWDM
NRNITEVGSVGLPANRQFEVVHRYILGVYDLYERLTRKFPDILFESCASGGARFDPGMLY
YAPQAWTSDNTDAIERLKIQYGTSFAYPISSMGAHVSAVPNHQVRRVTSLETRGDVAYFG
AFGYELDVTLMTEDEKETVKQQIQYYKKHRSLIQNGIFYRLKSPFEQDGNVTSWMVVSSD
QKQAIIGYYQVLARPNPSYERIELKGLQPDYEYTVMETDQTAYGDELMYAGIALTHEYSG
VEAYDEKSGDFVSVIYTLQAQ
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgggagtcttatttaatgaacgtacaaaggaatttcacctgcagggacgcgatgtaagt
tatatcttttcagtgttgagaaacgggcagctcggtcacttgtactatggaaaaaagctt
aagcaccgttcatcttttcagcattttttacgtgtagaaacaagaggagctagcgcttcg
gtatatgaaggagaactagcattttctcttgaaacaatcaaacaagagtatccttcttat
ggaacaacagacttcagagagccagcctatcaacttcttcagcaaaacggaagccgaatc
acaaattttgaatacgataaccataaaatttacaaaggcaagaagccattaaacggctta
cctgctacatatgtagaagaagagagtgaagccacaagtgtagaagttgaactgattgat
aaattgctcaatgcatcacttattttaacgtataccgtttacgaagaccgaaatattatt
acgcgtcacgcacgatttgagcatagaggggaagaagcagtcgatattttgcgtatcatg
agcggcagcattgatttgcctacatcaaattatgagatggttcagctttccggtgcgtgg
attcgagaaagacacgtgaaaacacgaatgcttcagcctggtattcaaagtatttctagt
gcgagaggtacaagcagcagtcagcaaaacccatttttaattttaaagaacccagatgca
actgaacacagtggagaagcgtatggttttagtcttgtatacagcggaaactttcttgga
caagtggaagtagatcattacaatgtatcaagaataacgatgggcattcatccttttgat
tttcagtggcgactagaaagtggacaaacttttcaatcaccagaactagtactggcttat
tcaaatagcgggctaaacggccttagccaagagtatcacgagctttatcgcaagcgtctt
gctagaggaaaatggcgggatttggagcggccagttttaattaataactgggaagcgacg
tattttgattttaacgaagagaaaattgtacatattgccaaagaagcgcaaaagctaggc
gttgaactttttgtattggatgacggctggttcggtaaacgtaacgatgatacaacttct
cttggagattggtttgtagatgaaaataagcttccgggcggtatgaagtcattggctcaa
aaagtaacggatttaggtatggactttgggttatggtttgaacctgaaatgatttcaaag
caaagcaacttgtatgaaaagcatccagattggttgattcatgtgccaaatcgttatcag
tctcatggacgaaatcaatatgtgcttgatttttcacgagaagaagtagtgaattatatc
tatgaacgaatggaagctattttaagtgaagcgcctatctcttatataaaatgggatatg
aatcgaaatataacggaggttggatctgttgggctgcccgcgaaccgtcagtttgaagta
gtacatcgctatattttaggtgtgtatgatttgtatgagcgactaacaaggaagtttccg
gatattttatttgaatcatgtgcaagcgggggcgctagatttgatccgggaatgctttat
tatgctcctcaagcttggacgagcgataacacggatgcgattgaacgtctaaaaattcag
tacggcacgtcttttgcctatccaatcagttcaatgggagcacacgtatcagccgtacca
aatcatcaagtacgcagagtaacaagtctagaaacaagaggagacgttgcgtattttggc
gcatttggttatgagttagatgttacgctgatgacagaagatgaaaaagaaaccgtaaaa
caacaaattcagtattataaaaaacaccgatctcttattcaaaatggcatattctatcgt
ttaaaaagtccgtttgaacaagatggaaatgtgacgagctggatggttgtttcatccgat
caaaaacaggcaatcatcggttattatcaagtattagctagaccaaatccttcttacgaa
cgcattgagctaaaagggcttcaacctgattatgaatatacagtgatggaaacagatcaa
acagcttatggagatgagctcatgtacgcaggtattgctctaactcatgagtattcgggt
gttgaagcatacgatgaaaaatctggagactttgtatcggttatttacacactgcaagcg
caataa

DBGET integrated database retrieval system