KEGG   Bacillus megaterium QM B1551: BMQ_0554Help
Entry
BMQ_0554          CDS       T01208                                 

Definition
(GenBank) phosphoglycerate mutase 1 family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00260  Glycine, serine and threonine metabolism
bmq00680  Methane metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
bmq01230  Biosynthesis of amino acids
Module
bmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmq_M00002  Glycolysis, core module involving three-carbon compounds
bmq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_0554
  Energy metabolism
   00680 Methane metabolism
    BMQ_0554
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_0554
Enzymes [BR:bmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMQ_0554
Membrane trafficking [BR:bmq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BMQ_0554
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMQ_0554
  Exosomal proteins of melanoma cells
   BMQ_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADE67611
UniProt: D5DYW9
Position
complement(517135..517860)
Genome map
AA seq 241 aa AA seqDB search
MIKLVLIRHGQSVWNLENKFTGWTDVDLSKNGLQEAREAGKVLKKNEYTFDIAYTSVLKR
SIRTLWIVLHQMDFMWIPIYKSWRLNERHYGALQGLNKEETAKKFGEEQVHLWRRSMNER
PPALKTTDIRYEASNPKYKELAKGQFPVTENLADTEKRVLEYWNETIAPSIKAGKKVIIS
AHGNTIRALMQYLDNISPDGIANLNIPTSVPLVYELDDNLKPLRHYYLGIDGEIPTHIPS
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtgttgattcggcacggacaaagcgtgtggaatctggaaaataaattt
acaggctggacggatgtagatctttctaaaaatggattgcaagaagcgcgagaagctgga
aaagtgctaaagaaaaacgaatatacttttgatattgcctatacttctgttttaaaacga
tccattcgcactctatggattgtcttacatcaaatggacttcatgtggattcccatatac
aaatcttggaggttgaatgaacggcactacggagctcttcaaggtttaaacaaagaagaa
accgcaaaaaaatttggagaagagcaagtacatttgtggagaaggtcgatgaacgaacgc
cctcctgctttaaagacaacagatattcgctatgaagcttccaaccctaagtataaggaa
ttagctaaaggacaatttcctgtaacggaaaacttagccgatacagaaaagcgggttcta
gaatattggaacgaaactattgctccttctattaaagctggcaaaaaggttattatttcc
gctcacggtaatacgattagagctctgatgcagtatttggataacatttcgcctgatggc
attgcgaacttgaatattcccacaagcgtgccgcttgtttatgagcttgatgataattta
aagccccttagacattattatttaggcatcgatggagagattcctacacatattccttct
tcataa

DBGET integrated database retrieval system