KEGG   Bacillus megaterium QM B1551: BMQ_0634Help
Entry
BMQ_0634          CDS       T01208                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_0634 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMQ_0634 (aceA)
Enzymes [BR:bmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMQ_0634 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584781..586064
Genome map
AA seq 427 aa AA seqDB search
MKDIRVKNLEENWKSDERWKGIERPYSAEKVIGLRGSIDIEHTLARRGAEKFWNLLKTEP
YVHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGNMYPDQSLYPANSVPHVVKRI
NQALQRADQIQHLEGEGNIDYFAPIVADAEAGFGGQLNVFELMKGMIESGASAVHFEDQL
SSEKKCGHLGGKVLLPTQTAVKNLIAARLAADVMGVPTLLIARTDADAADLITSDVDPVD
RQFITGERTAEGFYRTRAGIDQAIARGLAYAPYADLVWCETSEPNLEQAQKFADAIHEKF
PGKMLAYNCSPSFNWKKKLDKKTIEKFQREIAKMGYKFQFVTLAGFHALNHSMFELARGY
KTRGMAAYSELQEREFASEINGYTATRHQREVGTGYFDEVAQVVSGGTSSTTALKGSTEE
EQFQAHK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcgtgtaaaaaaccttgaagagaactggaaaagcgatgagcgttggaaa
ggaattgaacgtccatattctgcagaaaaagtcattgggctaagagggtccattgatatt
gaacatacgcttgctagaagaggagccgaaaagttctggaacttattaaaaacagagcca
tacgttcatgccttaggagctttaacaggaaatcaagcagtacaacaggtaaaagcaggg
ttaaaagcaatttacttaagcggatggcaagtagctgcagatgcaaatctttcaggaaac
atgtatcctgatcaaagtttatacccggcaaacagcgtgccgcatgttgtgaaacgaatc
aatcaagcgctgcagcgtgccgatcaaattcagcatttagaaggagaagggaatatcgat
tactttgctccaattgtagcagatgcagaagcagggtttggaggacagttaaacgtattt
gaactcatgaaaggaatgattgagtcgggagcatctgccgtacactttgaagatcaatta
tcctctgagaaaaagtgtggtcatctcggcgggaaggtattgcttccaactcaaaccgct
gtgaaaaacttgattgctgctcgtttagctgctgatgtaatgggtgttccaacacttctg
attgctcgtaccgatgctgatgctgctgatttaattacaagtgatgttgatcctgtagat
cgccagtttattacaggtgaacgcactgctgaaggtttttatcgcacgagagccggaatc
gatcaagctattgctcgcggcttagcatatgcgccatatgcggatctagtatggtgtgag
acgtctgaaccaaacttggaacaagcacaaaaatttgcagatgctattcatgaaaaattc
ccaggtaaaatgcttgcttataactgttcaccatctttcaactggaagaaaaaattagat
aagaaaacgattgaaaaattccaaagagaaatcgcaaaaatgggctacaaattccaattc
gttacgcttgctggcttccacgctttaaatcacagcatgtttgagctggcacgaggatat
aaaacaagaggaatggcagcttattcagagttacaagaaagagagtttgctagtgaaata
aatggatatactgctacaagacatcagcgtgaagtaggcacgggttattttgatgaagtg
gcgcaagtagtttctggtgggacttcctctacaacagctttaaaaggttcaacggaagaa
gagcagtttcaagcccataaataa

DBGET integrated database retrieval system