KEGG   Bacillus megaterium QM B1551: BMQ_0634Help
Entry
BMQ_0634          CDS       T01208                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_0634 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMQ_0634 (aceA)
Enzymes [BR:bmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMQ_0634 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584781..586064
Genome map
AA seq 427 aa AA seqDB search
MKDIRVKNLEENWKSDERWKGIERPYSAEKVIGLRGSIDIEHTLARRGAEKFWNLLKTEP
YVHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGNMYPDQSLYPANSVPHVVKRI
NQALQRADQIQHLEGEGNIDYFAPIVADAEAGFGGQLNVFELMKGMIESGASAVHFEDQL
SSEKKCGHLGGKVLLPTQTAVKNLIAARLAADVMGVPTLLIARTDADAADLITSDVDPVD
RQFITGERTAEGFYRTRAGIDQAIARGLAYAPYADLVWCETSEPNLEQAQKFADAIHEKF
PGKMLAYNCSPSFNWKKKLDKKTIEKFQREIAKMGYKFQFVTLAGFHALNHSMFELARGY
KTRGMAAYSELQEREFASEINGYTATRHQREVGTGYFDEVAQVVSGGTSSTTALKGSTEE
EQFQAHK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcgtgtaaaaaaccttgaagagaactggaaaagcgatgagcgttggaaa
ggaattgaacgtccatattctgcagaaaaagtcattgggctaagagggtccattgatatt
gaacatacgcttgctagaagaggagccgaaaagttctggaacttattaaaaacagagcca
tacgttcatgccttaggagctttaacaggaaatcaagcagtacaacaggtaaaagcaggg
ttaaaagcaatttacttaagcggatggcaagtagctgcagatgcaaatctttcaggaaac
atgtatcctgatcaaagtttatacccggcaaacagcgtgccgcatgttgtgaaacgaatc
aatcaagcgctgcagcgtgccgatcaaattcagcatttagaaggagaagggaatatcgat
tactttgctccaattgtagcagatgcagaagcagggtttggaggacagttaaacgtattt
gaactcatgaaaggaatgattgagtcgggagcatctgccgtacactttgaagatcaatta
tcctctgagaaaaagtgtggtcatctcggcgggaaggtattgcttccaactcaaaccgct
gtgaaaaacttgattgctgctcgtttagctgctgatgtaatgggtgttccaacacttctg
attgctcgtaccgatgctgatgctgctgatttaattacaagtgatgttgatcctgtagat
cgccagtttattacaggtgaacgcactgctgaaggtttttatcgcacgagagccggaatc
gatcaagctattgctcgcggcttagcatatgcgccatatgcggatctagtatggtgtgag
acgtctgaaccaaacttggaacaagcacaaaaatttgcagatgctattcatgaaaaattc
ccaggtaaaatgcttgcttataactgttcaccatctttcaactggaagaaaaaattagat
aagaaaacgattgaaaaattccaaagagaaatcgcaaaaatgggctacaaattccaattc
gttacgcttgctggcttccacgctttaaatcacagcatgtttgagctggcacgaggatat
aaaacaagaggaatggcagcttattcagagttacaagaaagagagtttgctagtgaaata
aatggatatactgctacaagacatcagcgtgaagtaggcacgggttattttgatgaagtg
gcgcaagtagtttctggtgggacttcctctacaacagctttaaaaggttcaacggaagaa
gagcagtttcaagcccataaataa

DBGET integrated database retrieval system