KEGG   Bacillus megaterium QM B1551: BMQ_0653Help
Entry
BMQ_0653          CDS       T01208                                 

Gene name
asnO
Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00250  Alanine, aspartate and glutamate metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMQ_0653 (asnO)
Enzymes [BR:bmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BMQ_0653 (asnO)
Peptidases [BR:bmq01002]
 Cysteine Peptidases
  Family C44
   BMQ_0653 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 FAD_binding_5 yqaH
Motif
Other DBs
NCBI-ProteinID: ADE67687
UniProt: D5DZW7
Position
608024..609871
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDLKRSLLNETATITKMADTLSKRGPDDTNVWTQQHVAFGHKRLVVVDPQGGR
QPMTREKNEQRYTLCYNGELYNTEDIRKELLKRGYQFQGHSDTEVLLTSYIEWKESCVDH
FNGIFAFSIWDEANEKLFIARDRMGVKPLFYRSYEGGIQFASELKAILAHPEVKAEVGLD
GLAEVFGLGPSRSPGHGVFKEINELRPAHALTLTRNGLKIWRYWNVKSEQHTDDLGETTE
KVKFLVQDAIVRQLVSDVPVCTFLSGGVDSSAITAIAANAFKESGKGSLHTYSIDYEDND
KFFKANEFQPNSDGTYIKLMSDTFQTNHHRCIISTEDLVQHLTEAVEVRDLPGMADVDSS
LLWFCREIKQDFVVSLSGECADEIFGGYPWFHRKHDLSSDTFPWMRSLDARIDLLQSSWR
KKLQLEDYVRARYEETLKEVPELEGESLEDAQRRKLFYLNQIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMTGNKEKGILRKALEGILPHDVLYRKKSPYPKTHNP
AYTKAVTVWLQSLLQDKQSPLHEFFDKQQLKHIIDTGGEGFKAPWFGQLMTGPQLLAHLA
QIHVWFTHNNIQIVE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtataacgggttgggtcgacttaaagcgatcgcttttaaatgaaacagcaaca
ataacaaaaatggctgacactttatcgaaaagaggtcctgatgacaccaacgtatggaca
cagcagcatgttgcttttgggcacaaacgcttagttgtagtagatcctcaaggcggaaga
cagccgatgacaagagaaaaaaatgaacagcgctatacgctttgctataatggagagctt
tacaacacggaagatattcggaaagaattactaaaaagaggttatcaatttcagggacat
tcagatacggaagtacttctaacatcttatatagaatggaaagaatcatgcgtagatcat
tttaacggtatctttgctttttcaatctgggacgaagccaatgaaaagttatttatagca
cgcgacagaatgggagtgaagcccttattctatcgatcttatgaaggtggaattcaattt
gcatcggaattaaaagcgatattagctcatcctgaggtgaaagccgaagtaggattagat
ggattagcagaagtgtttggcttaggaccttctcgttctcccggccacggcgtatttaaa
gaaataaatgaattgcgcccggctcacgccctcacgcttacgcgtaacgggttgaagatt
tggcgatactggaacgtaaaaagtgagcagcatacagatgatttaggtgaaactacagaa
aaagttaaatttttagtgcaagacgcgattgtaagacagctagtgtccgatgtcccggtt
tgtacatttttatcaggtggagtagattcaagcgccattacagcaattgctgcaaatgcg
ttcaaagaaagcggcaagggctctcttcatacgtattctatcgattatgaagacaatgat
aaattttttaaagcaaatgagtttcagccaaattctgatggaacttatatcaagctcatg
tcggatacgtttcaaacaaatcatcaccgctgcattatttcaacggaggaccttgtgcag
catttaacagaggctgtagaggtgagagaccttcctggaatggctgatgtagattcatcg
ctgctttggttttgccgtgaaatcaaacaagattttgttgtgagcttatcaggagaatgt
gcggatgaaatttttggaggatatccgtggtttcaccgaaaacatgatttgtcttcggat
accttcccatggatgcgttcattagatgctcgaattgatttgctgcaaagttcatggaga
aagaaattacagttagaagattatgtgcgtgcaagatatgaagaaacattaaaggaagtg
cctgaattagaaggtgaatcgttagaagatgcgcagcgaagaaagctgttttatttaaat
cagatttggtttatgacaactttattagatcgtaaagatcgtatgagcatgggcgcgagc
ttagaagtacgcgtaccttttgcagatcatcgccttgtggaatatgcatggaatattccg
tgggagatgaaaatgacgggcaataaagagaaggggattttacgaaaagcgcttgaagga
attttgcctcatgatgttctttatcgcaagaaaagcccttatcctaaaacgcataaccca
gcttatacaaaagctgtaactgtatggcttcaatctcttttacaagataaacagtcacct
cttcatgaattttttgataagcagcagttaaagcatattattgatacaggcggagaagga
tttaaagcaccttggtttggtcaattaatgacaggacctcagctgctagctcatctagct
caaattcacgtctggtttactcacaataatattcaaattgttgaatga

DBGET integrated database retrieval system