KEGG   Bacillus megaterium QM B1551: BMQ_0788Help
Entry
BMQ_0788          CDS       T01208                                 

Gene name
alsD
Definition
alpha-acetolactate decarboxylase (EC:4.1.1.5)
Orthology
K01575  
acetolactate decarboxylase [EC:4.1.1.5]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Butanoate metabolism
C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMQ_0788 (alsD)
   00660 C5-Branched dibasic acid metabolism
    BMQ_0788 (alsD)
Enzymes [BR:bmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     BMQ_0788 (alsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(757863..758576)
Genome map
AA seq 237 aa AA seqDB search
MSNKEKLTIHQTSTMIALLDGVFDGVVTYKDLAKKGDFGIGTFNQLDGEMIAFDGEFYHI
ADGKAAPISEDAKTPFAIMTTFYEDISYRVEKEMNREQLETLMNELIPSPNLFYAVRIDG
KFKEVKTRTVAKQEKPYPSMVDAAADQPTFTSSDVNGTLAGFYTPEYSSGIGVPGYHLHF
IDEYKKEGGHVLDVSVQDVTIQICKKTKLNLNLSETSEFLSANLEDHDVEEEIATAE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaagaaaaattaacgattcaccaaacttccactatgatcgctttattagac
ggagtatttgacggtgttgtcacatacaaggatttagctaagaaaggggatttcggcatt
ggtacgtttaatcaattggatggtgaaatgattgcctttgacggagaattttatcatatt
gctgatggtaaagccgcacctattagtgaagatgcaaaaacaccttttgccattatgaca
accttttatgaagatatctcttatcgtgtagaaaaggaaatgaatcgtgaacaactagaa
accttaatgaacgaacttattcctagccccaatttattctatgcagttcgcattgacggc
aagtttaaagaagtaaaaactcgcacggttgcaaagcaagaaaagccctatccttctatg
gtagatgcggctgctgatcagcctacatttacatcttcagatgtaaatggaacactagca
ggtttttacacgccagaatattcttcaggcatcggtgttcccggctaccacctgcacttt
attgatgaatataaaaaagaaggggggcatgttttagatgtctccgttcaggatgttaca
attcaaatctgcaaaaaaacgaaattaaatctcaatttatcggaaacaagtgaattttta
agtgctaatttagaagaccatgatgtagaagaagaaattgccacggctgaataa

DBGET integrated database retrieval system